Merge cvs-trunk-mirror to mozilla-central. One conflict resolution: updated NSPR tag from into
authorBenjamin Smedberg <>
Fri, 02 May 2008 14:08:43 -0400
changeset 14892 7a96b5181691d464af1bf0601e54c6b6b1763275
parent 14838 f337857f6837df02cf1a59e41afd2957622cc96a (current diff)
parent 14891 cc361750f3682ecc6d7718540a2093d39b99dae4 (diff)
child 14893 10570a93bf600edffc6b98c8ce1ef4583c4b8f92
push idunknown
push userunknown
push dateunknown
Merge cvs-trunk-mirror to mozilla-central. One conflict resolution: updated NSPR tag from into
--- a/accessible/src/html/nsHTMLSelectAccessible.cpp
+++ b/accessible/src/html/nsHTMLSelectAccessible.cpp
@@ -616,17 +616,17 @@ nsIFrame* nsHTMLSelectOptionAccessible::
 nsHTMLSelectOptionAccessible::GetState(PRUint32 *aState, PRUint32 *aExtraState)
   // Upcall to nsAccessible, but skip nsHyperTextAccessible impl
   nsresult rv = nsAccessible::GetState(aState, aExtraState);
-  NS_ENSURE_TRUE(rv, rv);
   if (!mDOMNode)
     return NS_OK;
   PRUint32 selectState, selectExtState;
   nsCOMPtr<nsIContent> selectContent = GetSelectState(&selectState,
   if (selectState & nsIAccessibleStates::STATE_INVISIBLE) {
     return NS_OK;
--- a/browser/app/profile/firefox.js
+++ b/browser/app/profile/firefox.js
@@ -440,16 +440,17 @@ pref("profile.allow_automigration", fals
 pref("custtoolbar.personal_toolbar_folder", "");
 // pref to control the alert notification 
 pref("alerts.slideIncrement", 1);
 pref("alerts.slideIncrementTime", 10);
 pref("alerts.totalOpenTime", 4000);
 pref("browser.xul.error_pages.enabled", true);
+pref("browser.xul.error_pages.expert_bad_cert", false);
 // We want to make sure mail URLs are handled externally...
 pref("network.protocol-handler.external.mailto", true); // for mail
 pref("", true);   // for news
 pref("network.protocol-handler.external.snews", true);  // for secure news
 pref("network.protocol-handler.external.nntp", true);   // also news
 // ...without warning dialogs
 pref("network.protocol-handler.warn-external.mailto", false);
@@ -629,16 +630,23 @@ pref("urlclassifier.gethashnoise", 4);
 // The list of tables that use the gethash request to confirm partial results.
 pref("urlclassifier.gethashtables", "goog-phish-shavar,goog-malware-shavar");
 // If an urlclassifier table has not been updated in this number of seconds,
 // a gethash request will be forced to check that the result is still in
 // the database.
 pref("urlclassifier.confirm-age", 2700);
+// Maximum size of the sqlite3 cache during an update, in bytes
+pref("urlclassifier.updatecachemax", 104857600);
+pref("urlclassifier.updatecachemax", -1);
 // URL for checking the reason for a malware warning.
 pref("browser.safebrowsing.malware.reportURL", "");
 // defaults to true
 pref("browser.EULA.2.accepted", true);
--- a/browser/base/content/
+++ b/browser/base/content/
@@ -307,15 +307,32 @@
 #ifdef XP_MACOSX
     <key id="key_sanitize_mac" command="Tools:Sanitize" keycode="VK_BACK" modifiers="accel,shift"/>
 #ifdef XP_UNIX
     <key id="key_quitApplication" key="&quitApplicationCmdMac.key;" command="cmd_quitApplication" modifiers="accel"/>
     <key id="key_undoCloseTab" command="History:UndoCloseTab" key="&tabCmd.commandkey;" modifiers="accel,shift"/>
+#ifdef XP_GNOME
+#expand    <key id="key_selectTab1" oncommand="BrowserNumberTabSelection(event, 0);" key="1" modifiers="__NUM_SELECT_TAB_MODIFIER__"/>
+#expand    <key id="key_selectTab2" oncommand="BrowserNumberTabSelection(event, 1);" key="2" modifiers="__NUM_SELECT_TAB_MODIFIER__"/>
+#expand    <key id="key_selectTab3" oncommand="BrowserNumberTabSelection(event, 2);" key="3" modifiers="__NUM_SELECT_TAB_MODIFIER__"/>
+#expand    <key id="key_selectTab4" oncommand="BrowserNumberTabSelection(event, 3);" key="4" modifiers="__NUM_SELECT_TAB_MODIFIER__"/>
+#expand    <key id="key_selectTab5" oncommand="BrowserNumberTabSelection(event, 4);" key="5" modifiers="__NUM_SELECT_TAB_MODIFIER__"/>
+#expand    <key id="key_selectTab6" oncommand="BrowserNumberTabSelection(event, 5);" key="6" modifiers="__NUM_SELECT_TAB_MODIFIER__"/>
+#expand    <key id="key_selectTab7" oncommand="BrowserNumberTabSelection(event, 6);" key="7" modifiers="__NUM_SELECT_TAB_MODIFIER__"/>
+#expand    <key id="key_selectTab8" oncommand="BrowserNumberTabSelection(event, 7);" key="8" modifiers="__NUM_SELECT_TAB_MODIFIER__"/>
+#expand    <key id="key_selectTab9" oncommand="BrowserNumberTabSelection(event, 8);" key="9" modifiers="__NUM_SELECT_TAB_MODIFIER__"/>
 # Used by baseMenuOverlay
 #ifdef XP_MACOSX
   <commandset id="baseMenuCommandSet" />
   <keyset id="baseMenuKeyset" />
--- a/browser/base/content/browser.js
+++ b/browser/base/content/browser.js
@@ -906,17 +906,17 @@ function delayedStartup()
   if (!gPrefService)
     gPrefService = Components.classes[";1"]
   gBrowser.addEventListener("pageshow", function(evt) { setTimeout(pageShowEventHandlers, 0, evt); }, true);
-  window.addEventListener("keypress", ctrlNumberTabSelection, false);
+  window.addEventListener("keypress", onBrowserKeyPress, false);
   // Ensure login manager is up and running.
   if (gMustLoadSidebar) {
     var sidebar = document.getElementById("sidebar");
     var sidebarBox = document.getElementById("sidebar-box");
     sidebar.setAttribute("src", sidebarBox.getAttribute("src"));
@@ -1294,60 +1294,32 @@ SanitizeListener.prototype =
     var label = gPrefService.getBoolPref(this.promptDomain) ?
         gNavigatorBundle.getString("sanitizeWithPromptLabel") : 
     document.getElementById("sanitizeItem").setAttribute("label", label);
-function ctrlNumberTabSelection(event)
+function onBrowserKeyPress(event)
   if (event.altKey && event.keyCode == KeyEvent.DOM_VK_RETURN) {
     // XXXblake Proper fix is to just check whether focus is in the urlbar. However, focus with the autocomplete widget is all
     // hacky and broken and there's no way to do that right now. So this just patches it to ensure that alt+enter works when focus
     // is on a link.
     if (!(document.commandDispatcher.focusedElement instanceof HTMLAnchorElement)) {
       // Don't let winxp beep on ALT+ENTER, since the URL bar uses it.
-#ifdef XP_MACOSX
-  // Mac: Cmd+number
-  if (!event.metaKey || event.ctrlKey || event.altKey || event.shiftKey)
-#ifdef XP_UNIX
-  // Linux: Alt+number
-  if (!event.altKey || event.ctrlKey || event.metaKey || event.shiftKey)
-  // Windows: Ctrl+number
-  if (!event.ctrlKey || event.metaKey || event.altKey || event.shiftKey)
-    return;
-  // \d in a RegExp will find any Unicode character with the "decimal digit"
-  // property (Nd)
-  var regExp = /\d/;
-  if (!regExp.test(String.fromCharCode(event.charCode)))
-    return;
-  // Some Unicode decimal digits are in the range U+xxx0 - U+xxx9 and some are
-  // in the range U+xxx6 - U+xxxF. Find the digit 1 corresponding to our
-  // character.
-  var digit1 = (event.charCode & 0xFFF0) | 1;
-  if (!regExp.test(String.fromCharCode(digit1)))
-    digit1 += 6;
-  var index = event.charCode - digit1;
-  if (index < 0)
-    return;
+function BrowserNumberTabSelection(event, index)
   // [Ctrl]+[9] always selects the last tab
   if (index == 8)
     index = gBrowser.tabContainer.childNodes.length - 1;
   else if (index >= gBrowser.tabContainer.childNodes.length)
   var oldTab = gBrowser.selectedTab;
   var newTab = gBrowser.tabContainer.childNodes[index];
--- a/browser/components/feeds/content/subscribe.xhtml
+++ b/browser/components/feeds/content/subscribe.xhtml
@@ -12,18 +12,17 @@
     SYSTEM "chrome://browser/locale/feeds/subscribe.dtd">
 <?xml-stylesheet href="chrome://global/skin/" type="text/css"?>
 <html id="feedHandler"
-      xmlns:xul=""
-      xmlns:aaa="">
+      xmlns:xul="">
     <link rel="stylesheet"
     <script type="application/x-javascript"
@@ -36,17 +35,17 @@
 <!-- XXXmano this can't have any whitespace in it.  Otherwise you would see
      how much XUL-in-XHTML sucks, see bug 348830 -->
         <div id="feedSubscribeLine"
             ><xul:hbox align="center" 
               ><xul:description id="subscribeUsingDescription"
-              /><xul:menulist id="handlersMenuList" aaa:labelledby="subscribeUsingDescription"
+              /><xul:menulist id="handlersMenuList" aria-labelledby="subscribeUsingDescription"
                 ><xul:menupopup menugenerated="true" id="handlersMenuPopup"
                   ><xul:menuitem id="liveBookmarksMenuItem" label="&feedLiveBookmarks;" class="menuitem-iconic" image="chrome://browser/skin/page-livemarks.png" selected="true"
               ><xul:checkbox id="alwaysUse" checked="false"
--- a/browser/components/feeds/src/FeedWriter.js
+++ b/browser/components/feeds/src/FeedWriter.js
@@ -389,18 +389,22 @@ FeedWriter.prototype = {
    * Writes the feed title into the preview document.
    * @param   container
    *          The feed container
   _setTitleText: function FW__setTitleText(container) {
     if (container.title) {
-      this._setContentText(TITLE_ID, container.title.plainText());
-      this._document.title = container.title.plainText();
+      var title = container.title.plainText();
+      this._setContentText(TITLE_ID, title);
+      this._contentSandbox.document = this._document;
+      this._contentSandbox.title = title;
+      var codeStr = "document.title = title;"
+      Cu.evalInSandbox(codeStr, this._contentSandbox);
     var feed = container.QueryInterface(Ci.nsIFeed);
     if (feed && feed.subtitle)
       this._setContentText(SUBTITLE_ID, container.subtitle.plainText());
@@ -419,29 +423,31 @@ FeedWriter.prototype = {
       // Set up the title image link
       var feedTitleLink = this._document.getElementById("feedTitleLink");
       var titleText = this._getFormattedString("linkTitleTextFormat", 
       this._contentSandbox.feedTitleLink = feedTitleLink;
       this._contentSandbox.titleText = titleText;
-      var codeStr = "feedTitleLink.setAttribute('title', titleText);";
+      this._contentSandbox.feedTitleText = this._document.getElementById("feedTitleText");
+      this._contentSandbox.titleImageWidth = parseInt(parts.getPropertyAsAString("width")) + 15;
+      // Fix the margin on the main title, so that the image doesn't run over
+      // the underline
+      var codeStr = "feedTitleLink.setAttribute('title', titleText); " +
+                    " = titleImageWidth + 'px';";
       Cu.evalInSandbox(codeStr, this._contentSandbox);
       this._contentSandbox.feedTitleLink = null;
       this._contentSandbox.titleText = null;
+      this._contentSandbox.feedTitleText = null;
+      this._contentSandbox.titleImageWidth = null;
       this._safeSetURIAttribute(feedTitleLink, "href", 
-      // Fix the margin on the main title, so that the image doesn't run over
-      // the underline
-      var feedTitleText = this._document.getElementById("feedTitleText");
-      var titleImageWidth = parseInt(parts.getPropertyAsAString("width")) + 15;
- = titleImageWidth + "px";
     catch (e) {
       LOG("Failed to set Title Image (this is benign): " + e);
    * Writes all entries contained in the feed.
@@ -954,17 +960,16 @@ FeedWriter.prototype = {
       case Ci.nsIFeed.TYPE_AUDIO:
         codeStr = "header.className = 'audioPodcastBackground'; ";
         codeStr = "header.className = 'feedBackground'; ";
-        header.className = "feedBackground";
     // Last-selected application
     var menuItem = this._document.createElementNS(XUL_NS, "menuitem"); = "selectedAppMenuItem";
     menuItem.className = "menuitem-iconic";
     menuItem.setAttribute("handlerType", "client");
--- a/browser/components/nsBrowserGlue.js
+++ b/browser/components/nsBrowserGlue.js
@@ -448,24 +448,22 @@ BrowserGlue.prototype = {
         // if there's no JSON backup or we are restoring default bookmarks
         // ensurePlacesDefaultQueriesInitialized() is called by import.
         prefBranch.setIntPref("browser.places.smartBookmarksVersion", 0);
         var dirService = Cc[";1"].
-        if (restoreDefaultBookmarks) {
+        var bookmarksFile = dirService.get("BMarks", Ci.nsILocalFile);
+        if (restoreDefaultBookmarks || !bookmarksFile.exists()) {
           // get bookmarks.html file from default profile folder
-          var bookmarksFileName = "bookmarks.html";
-          var bookmarksFile = dirService.get("profDef", Ci.nsILocalFile);
-          bookmarksFile.append(bookmarksFileName);
+          bookmarksFile = dirService.get("profDef", Ci.nsILocalFile);
+          bookmarksFile.append("bookmarks.html");
-        else
-          var bookmarksFile = dirService.get("BMarks", Ci.nsILocalFile);
         // import the file
         try {
           var importer = Cc[";1"].
           importer.importHTMLFromFile(bookmarksFile, true /* overwrite existing */);
         } catch (err) {
           // Report the error, but ignore it.
--- a/browser/components/places/content/bookmarkProperties.js
+++ b/browser/components/places/content/bookmarkProperties.js
@@ -462,17 +462,17 @@ var BookmarkPropertiesPanel = {
     if (this._uri)
       isQuery = this._uri.schemeIs("place");
     this._element("namePicker").hidden =
       hiddenRows.indexOf("title") != -1;
     this._element("locationRow").hidden =
       hiddenRows.indexOf("location") != -1 || isQuery || !isBookmark;
     this._element("keywordRow").hidden =
-      hiddenRows.indexOf("location") != -1 || isQuery || !isBookmark;
+      hiddenRows.indexOf("keyword") != -1 || isQuery || !isBookmark;
     this._element("descriptionRow").hidden =
       hiddenRows.indexOf("description")!= -1
     this._element("folderRow").hidden =
       hiddenRows.indexOf("folder picker") != -1 || this._action == ACTION_EDIT;
     this._element("livemarkFeedLocationRow").hidden =
       hiddenRows.indexOf("feedURI") != -1 || !isLivemark;
     this._element("livemarkSiteLocationRow").hidden =
       hiddenRows.indexOf("siteURI") != -1 || !isLivemark;
--- a/browser/components/places/content/controller.js
+++ b/browser/components/places/content/controller.js
@@ -984,16 +984,19 @@ PlacesController.prototype = {
    * Removes the selection
    * @param   aTxnName
    *          A name for the transaction if this is being performed
    *          as part of another operation.
   remove: function PC_remove(aTxnName) {
+    if (!this._hasRemovableSelection(false))
+      return;
     NS_ASSERT(aTxnName !== undefined, "Must supply Transaction Name");
     var root = this._view.getResult().root;
     if (PlacesUtils.nodeIsFolder(root)) 
     else if (PlacesUtils.nodeIsQuery(root)) {
       var queryType = asQuery(root).queryOptions.queryType;
--- a/browser/components/places/content/places.js
+++ b/browser/components/places/content/places.js
@@ -225,17 +225,18 @@ var PlacesOrganizer = {
     // Make sure the search UI is hidden.
     if (resetSearchBox) {
       var searchFilter = document.getElementById("searchFilter");
-    this._fillDetailsPane(node);
+    if (this._places.treeBoxObject.focused)
+      this._fillDetailsPane(node);
    * Sets the search scope based on node's properties
    * @param   aNode
    *          the node to set up scope from
   _setSearchScopeForNode: function PO__setScopeForNode(aNode) {
@@ -614,17 +615,18 @@ var PlacesOrganizer = {
     var canvas = document.getElementById("itemThumbnail");
     var height = previewBox.boxObject.height;
     var width = height * (screen.width / screen.height);
     canvas.width = width;
     canvas.height = height;
   onContentTreeSelect: function PO_onContentTreeSelect() {
-    this._fillDetailsPane(this._content.selectedNode);
+    if (this._content.treeBoxObject.focused)
+      this._fillDetailsPane(this._content.selectedNode);
   _fillDetailsPane: function PO__fillDetailsPane(aSelectedNode) {
     var infoBox = document.getElementById("infoBox");
     var detailsDeck = document.getElementById("detailsDeck");
     // If a textbox within a panel is focused, force-blur it so its contents
     // are saved
@@ -638,17 +640,16 @@ var PlacesOrganizer = {
       // don't update the panel if we are already editing this node
       if (aSelectedNode && gEditItemOverlay.itemId == aSelectedNode.itemId &&
           detailsDeck.selectedIndex == 1)
     if (aSelectedNode && !PlacesUtils.nodeIsSeparator(aSelectedNode)) {
       detailsDeck.selectedIndex = 1;
-      infoBox.hidden = false;
       // Using the concrete itemId is arguably wrong. The bookmarks API
       // does allow setting properties for folder shortcuts as well, but since
       // the UI does not distinct between the couple, we better just show
       // the concrete item properties.
       if (aSelectedNode.type ==
           Ci.nsINavHistoryResultNode.RESULT_TYPE_FOLDER_SHORTCUT) {
                                   { hiddenRows: ["folderPicker"],
@@ -659,19 +660,16 @@ var PlacesOrganizer = {
         gEditItemOverlay.initPanel(itemId != -1 ? itemId :
                                    { hiddenRows: ["folderPicker"] });
     else {
       detailsDeck.selectedIndex = 0;
-      // The details deck has the height of its biggest child, so we hide the
-      // infoBox to allow it shrinking when there is no selection.
-      infoBox.hidden = true;
       var selectItemDesc = document.getElementById("selectItemDescription");
       var itemsCountLabel = document.getElementById("itemsCountText");
       var rowCount = this._content.treeBoxObject.view.rowCount;
       if (rowCount == 0) {
         selectItemDesc.hidden = true;
         itemsCountLabel.value = PlacesUIUtils.getString("detailsPane.noItems");
       else {
--- a/browser/components/places/content/places.xul
+++ b/browser/components/places/content/places.xul
@@ -488,29 +488,30 @@
                 <treecol label="&col.dateadded.label;" id="placesContentDateAdded" anonid="dateAdded" flex="1" hidden="true"
                          persist="width hidden ordinal sortActive sortDirection"/>
                 <splitter class="tree-splitter"/>
                 <treecol label="&col.lastmodified.label;" id="placesContentLastModified" anonid="lastModified" flex="1" hidden="true"
                          persist="width hidden ordinal sortActive sortDirection"/>
               <treechildren flex="1"/>
-            <hbox id="infoPaneBox">
+            <hbox id="infoPaneBox" style="height: 11em;">
               <deck flex="1" id="detailsDeck">
                 <vbox id="itemsCountBox" align="center">
                   <spacer flex="3"/>
                   <label id="itemsCountText"/>
                   <spacer flex="1"/>
                   <description id="selectItemDescription">
                   <spacer flex="3"/>
                 <vbox id="infoBox" minimal="true">
                   <vbox id="editBookmarkPanelContent"/>
+                  <spacer flex="1"/>
                     <button type="image" id="infoBoxExpander"
--- a/browser/components/places/content/treeView.js
+++ b/browser/components/places/content/treeView.js
@@ -322,20 +322,19 @@ PlacesTreeView.prototype = {
     if (replaceCount != newElements.length) {
       for (i = startReplacement + newElements.length;
            i < this._visibleElements.length; i ++) {
         this._visibleElements[i].node.viewIndex = i;
     // now update the number of elements
-    if (previouslySelectedNodes.length > 0)
-      selection.selectEventsSuppressed = true;
+    selection.selectEventsSuppressed = true;
+    this._tree.beginUpdateBatch();
-    this._tree.beginUpdateBatch();
     if (replaceCount)
       this._tree.rowCountChanged(startReplacement, -replaceCount);
     if (newElements.length)
       this._tree.rowCountChanged(startReplacement, newElements.length);
     if (!this._flatList) {
       // now, open any containers that were persisted
       for (var i = 0; i < toOpenElements.length; i++) {
@@ -344,18 +343,18 @@ PlacesTreeView.prototype = {
         // avoid recursively opening containers
         while (parent) {
           if (parent.uri == item.uri)
           parent = parent.parent;
         // if we don't have a parent, we made it all the way to the root
         // and didn't find a match, so we can open our item
-        if (!parent)
-          item.containerOpen = !item.containerOpen;
+        if (!parent && !item.containerOpen)
+          item.containerOpen = true;
     // restore selection
     if (previouslySelectedNodes.length > 0) {
       for (var i = 0; i < previouslySelectedNodes.length; i++) {
@@ -389,19 +388,18 @@ PlacesTreeView.prototype = {
       // if only one node was previously selected and there's no selection now,
       // select the node at its old-viewIndex, if any
       if (previouslySelectedNodes.length == 1 &&
           selection.getRangeCount() == 0 &&
           this._visibleElements.length > previouslySelectedNodes[0].oldIndex) {
                                previouslySelectedNodes[0].oldIndex, true);
-      selection.selectEventsSuppressed = false;
+    selection.selectEventsSuppressed = false;
   _convertPRTimeToString: function PTV__convertPRTimeToString(aTime) {
     var timeInMilliseconds = aTime / 1000; // PRTime is in microseconds
     var timeObj = new Date(timeInMilliseconds);
     // Check if it is today and only display the time.  Only bother
     // checking for today if it's within the last 24 hours, since
--- a/browser/components/places/tests/browser/browser_425884.js
+++ b/browser/components/places/tests/browser/browser_425884.js
@@ -52,52 +52,59 @@ function test() {
    - validate folder B (empty)
    - redo copy transaction
    - validate folder B's contents
   var toolbarId = PlacesUtils.toolbarFolderId;
   var toolbarNode = PlacesUtils.getFolderContents(toolbarId).root;
-  is(toolbarNode.childCount, 0, "confirm toolbar is empty");
+  var oldCount = toolbarNode.childCount;
+  var testRootId = PlacesUtils.bookmarks.createFolder(toolbarId, "test root", -1);
+  is(toolbarNode.childCount, oldCount+1, "confirm test root node is a container, and is empty");
+  var testRootNode = toolbarNode.getChild(toolbarNode.childCount-1);
+  testRootNode.QueryInterface(Ci.nsINavHistoryContainerResultNode);
+  testRootNode.containerOpen = true;
+  is(testRootNode.childCount, 0, "confirm test root node is a container, and is empty");
   // create folder A, fill it, validate it's contents
-  var folderAId = PlacesUtils.bookmarks.createFolder(toolbarId, "A", -1);
+  var folderAId = PlacesUtils.bookmarks.createFolder(testRootId, "A", -1);
   var folderANode = PlacesUtils.getFolderContents(folderAId).root;
-  is(toolbarNode.childCount, 1, "create test folder");
+  is(testRootNode.childCount, 1, "create test folder");
   // copy it, using the front-end helper functions
   var serializedNode = PlacesUtils.wrapNode(folderANode, PlacesUtils.TYPE_X_MOZ_PLACE_CONTAINER);
   var rawNode = PlacesUtils.unwrapNodes(serializedNode, PlacesUtils.TYPE_X_MOZ_PLACE_CONTAINER).shift();
   // confirm serialization
   ok(rawNode.type, "confirm json node");
   var transaction = PlacesUIUtils.makeTransaction(rawNode,
-                                                  toolbarId,
+                                                  testRootId,
   ok(transaction, "create transaction");
   // confirm copy
-  is(toolbarNode.childCount, 2, "create test folder via copy");
+  is(testRootNode.childCount, 2, "create test folder via copy");
   // validate the copy
-  var folderBNode = toolbarNode.getChild(1);
+  var folderBNode = testRootNode.getChild(1);
   // undo the transaction, confirm the removal
-  is(toolbarNode.childCount, 1, "confirm undo removed the copied folder");
+  is(testRootNode.childCount, 1, "confirm undo removed the copied folder");
   // redo the transaction
-  is(toolbarNode.childCount, 2, "confirm redo re-copied the folder");
-  folderBNode = toolbarNode.getChild(1);
+  is(testRootNode.childCount, 2, "confirm redo re-copied the folder");
+  folderBNode = testRootNode.getChild(1);
   // clean up
 function populate(aFolderId) {
--- a/browser/themes/gnomestripe/browser/browser.css
+++ b/browser/themes/gnomestripe/browser/browser.css
@@ -200,17 +200,17 @@ menuitem.bookmark-item {
   list-style-image: url("chrome://browser/skin/places/query.png");
 .bookmark-item[query][tagContainer] {
   list-style-image: url("chrome://mozapps/skin/places/tagContainerIcon.png");
 .bookmark-item[query][dayContainer] {
-  list-style-image: url("moz-icon://stock/gtk-directory?size=menu");
+  list-style-image: url("chrome://browser/skin/places/calendar.png");
 .bookmark-item[query][hostContainer] {
   list-style-image: url("moz-icon://stock/gtk-directory?size=menu");
 .bookmark-item[query][hostContainer][open] {
   list-style-image: url("moz-icon://stock/gtk-directory?size=menu");
@@ -832,25 +832,27 @@ toolbar[iconsize="small"] #paste-button[
   direction: rtl;
 #PopupAutoComplete .autocomplete-treebody {
   direction: ltr;
 /* Favicon */
 #urlbar-throbber {
   width: 16px;
   height: 16px;
 #page-proxy-stack {
-  margin: 2px 3px;
+  width: 24px;
+  height: 20px;
+  padding: 2px 4px;
+  background: url(urlbar-favicon-glow.png) center center no-repeat;
 #page-proxy-favicon:not([src]) {
   list-style-image: url("chrome://global/skin/icons/folder-item.png");
   -moz-image-region: rect(0px, 16px, 16px, 0px);
 #page-proxy-favicon[pageproxystate="invalid"] {
--- a/browser/themes/gnomestripe/browser/
+++ b/browser/themes/gnomestripe/browser/
@@ -18,16 +18,17 @@ classic.jar:
+  skin/classic/browser/urlbar-favicon-glow.png
   skin/classic/browser/feeds/feedIcon.png             (feeds/feedIcon.png)
   skin/classic/browser/feeds/feedIcon16.png           (feeds/feedIcon16.png)
   skin/classic/browser/feeds/videoFeedIcon.png        (feeds/videoFeedIcon.png)
   skin/classic/browser/feeds/videoFeedIcon16.png      (feeds/videoFeedIcon16.png)
   skin/classic/browser/feeds/audioFeedIcon.png        (feeds/audioFeedIcon.png)
   skin/classic/browser/feeds/audioFeedIcon16.png      (feeds/audioFeedIcon16.png)
   skin/classic/browser/feeds/subscribe.css            (feeds/subscribe.css)
 * skin/classic/browser/places/bookmarkProperties.css  (places/bookmarkProperties.css)
--- a/browser/themes/gnomestripe/browser/places/places.css
+++ b/browser/themes/gnomestripe/browser/places/places.css
@@ -60,22 +60,24 @@ treechildren::-moz-tree-image(container,
   -moz-image-region: auto;
 /* query-nodes should be styled even if they're not expandable */
 treechildren::-moz-tree-image(title, query) {
   list-style-image: url("chrome://browser/skin/places/query.png");
-treechildren::-moz-tree-image(title, query, tagContainer) {
+treechildren::-moz-tree-image(title, query, tagContainer),
+treechildren::-moz-tree-image(container, OrganizerQuery_Tags) {
   list-style-image: url("chrome://mozapps/skin/places/tagContainerIcon.png");
+/* calendar icon for folders grouping items by date */
 treechildren::-moz-tree-image(title, query, dayContainer) {
-  list-style-image: url("moz-icon://stock/gtk-directory?size=menu");
+  list-style-image: url("chrome://browser/skin/places/calendar.png");
 treechildren::-moz-tree-image(title, query, hostContainer) {
   list-style-image: url("moz-icon://stock/gtk-directory?size=menu");
 treechildren::-moz-tree-image(title, query, hostContainer, open) {
   list-style-image: url("moz-icon://stock/gtk-directory?size=menu");
new file mode 100644
index e69de29bb2d1d6434b8b29ae775ad8c2e48c5391..19de6ff972550759b8eedb5b2caf6146d599973f
GIT binary patch
literal 619
--- a/browser/themes/pinstripe/browser/places/places.css
+++ b/browser/themes/pinstripe/browser/places/places.css
@@ -139,17 +139,18 @@ treechildren::-moz-tree-image(container,
   list-style-image: url("chrome://browser/skin/places/unfiledBookmarks.png");
 /* query-nodes should be styled even if they're not expandable */
 treechildren::-moz-tree-image(query) {
   list-style-image: url("chrome://browser/skin/places/query.png");
-treechildren::-moz-tree-image(title, query, tagContainer) {
+treechildren::-moz-tree-image(title, query, tagContainer),
+treechildren::-moz-tree-image(container, OrganizerQuery_Tags) {
   list-style-image: url("chrome://mozapps/skin/places/tagContainerIcon.png");
 treechildren::-moz-tree-image(title, query, dayContainer) {
   list-style-image: url("chrome://global/skin/tree/folder.png");
 treechildren::-moz-tree-image(title, query, hostContainer) {
index a6e76921f2f5d4930a0d100b384093aefa793327..fd32d714d615b7d00f2454ca5a4f9133508cb090
GIT binary patch
literal 592
--- a/browser/themes/winstripe/browser/browser-aero.css
+++ b/browser/themes/winstripe/browser/browser-aero.css
@@ -19,17 +19,17 @@
 #identity-box[chromedir="ltr"]:-moz-system-metric(windows-default-theme) {
   -moz-margin-start: -6px;
 #identity-box[chromedir="ltr"]:-moz-system-metric(windows-default-theme) > hbox {
   margin: -4px 0;
-  padding: 3px 2px 3px 4px;
+  padding: 3px 1px 3px 3px;
   background-position: 0 3px;
   -moz-border-radius-topleft: 14px;
   -moz-border-radius-bottomleft: 14px;
 #identity-box:hover[chromedir="ltr"]:-moz-system-metric(windows-default-theme) > hbox {
   background-position: 0 -57px;
 #identity-box.verifiedDomain[chromedir="ltr"]:-moz-system-metric(windows-default-theme) > hbox {
--- a/browser/themes/winstripe/browser/browser.css
+++ b/browser/themes/winstripe/browser/browser.css
@@ -181,18 +181,18 @@ menuitem.bookmark-item {
 .bookmark-item[query][tagContainer] {
   list-style-image: url("chrome://mozapps/skin/places/tagContainerIcon.png");
   -moz-image-region: auto;
 .bookmark-item[query][dayContainer] {
-  list-style-image: url("chrome://global/skin/icons/folder-item.png");
-  -moz-image-region: rect(0px, 32px, 16px, 16px);
+  list-style-image: url("chrome://browser/skin/places/calendar.png");
+  -moz-image-region: auto;
 .bookmark-item[query][hostContainer] {
   list-style-image: url("chrome://global/skin/icons/folder-item.png");
   -moz-image-region: rect(0px, 32px, 16px, 16px);
 .bookmark-item[query][hostContainer][open] {
@@ -1112,25 +1112,27 @@ toolbar[iconsize="small"] #paste-button:
 #PopupAutoCompleteRichResult {
   direction: ltr !important;
 /* ::::: page proxy icon ::::: */
 #urlbar-throbber {
   width: 16px;
   height: 16px;
 #page-proxy-stack {
-  margin: 2px 3px;
+  width: 24px;
+  height: 20px;
+  padding: 2px 4px;
+  background: url(urlbar-favicon-glow.png) center center no-repeat;
 #page-proxy-favicon:not([src]) {
   list-style-image: url("chrome://global/skin/icons/folder-item.png");
   -moz-image-region: rect(0px, 16px, 16px, 0px)
 #page-proxy-favicon[pageproxystate="invalid"] {
@@ -1833,25 +1835,25 @@ toolbarbutton.bookmark-item[dragover="tr
 #identity-box > hbox {
   background: -moz-dialog url(navbar-textbox-buttons.png) repeat-x;
   color: -moz-dialogText;
   border-left: 2px solid;
   border-right: 2px solid;
   -moz-border-left-colors: ThreeDShadow rgba(255, 255, 255, 0.2);
   -moz-border-right-colors: ThreeDShadow rgba(255, 255, 255, 0.2);
-  padding: 0 2px;
+  padding: 0 1px;
 #identity-box[chromedir="ltr"]:not(:-moz-system-metric(windows-default-theme)) > hbox {
   border-left: 1px solid;
   -moz-border-left-colors: rgba(255, 255, 255, 0.2);
 #identity-box[chromedir="ltr"]:-moz-system-metric(windows-default-theme) > hbox {
   margin: -11px -10px -11px 0;
-  padding: 10px 12px 10px 4px;
+  padding: 10px 11px 10px 3px;
   border-top: 1px solid ThreeDDarkShadow;
   border-bottom: 1px solid ThreeDDarkShadow;
   border-right-style: none;
   -moz-border-radius-topleft: 21px;
   -moz-border-radius-bottomleft: 21px;
   -moz-border-left-colors: ThreeDDarkShadow rgba(255, 255, 255, 0.4);
   background-position: 0 10px;
--- a/browser/themes/winstripe/browser/
+++ b/browser/themes/winstripe/browser/
@@ -28,17 +28,18 @@ classic.jar:
         skin/classic/browser/Search-glass.png                        (Search-glass.png)
         skin/classic/browser/Search-glass-rtl.png                    (Search-glass-rtl.png)
         skin/classic/browser/menu-back.png                           (menu-back.png)
         skin/classic/browser/menu-forward.png                        (menu-forward.png)
-        skin/classic/browser/navbar-textbox-buttons.png              (navbar-textbox-buttons.png)
+        skin/classic/browser/navbar-textbox-buttons.png
+        skin/classic/browser/urlbar-favicon-glow.png
         skin/classic/browser/feeds/feed-icons-16.png                 (feeds/feed-icons-16.png)
         skin/classic/browser/feeds/feedIcon.png                      (feeds/feedIcon.png)
         skin/classic/browser/feeds/feedIcon16.png                    (feeds/feedIcon16.png)
         skin/classic/browser/feeds/audioFeedIcon.png                 (feeds/audioFeedIcon.png)
         skin/classic/browser/feeds/audioFeedIcon16.png               (feeds/audioFeedIcon16.png)
         skin/classic/browser/feeds/videoFeedIcon.png                 (feeds/videoFeedIcon.png)
         skin/classic/browser/feeds/videoFeedIcon16.png               (feeds/videoFeedIcon16.png)
         skin/classic/browser/feeds/subscribe.css                     (feeds/subscribe.css)
@@ -115,16 +116,17 @@ classic.jar:
         skin/classic/aero/browser/Search-glass-rtl.png               (Search-glass-rtl-aero.png)
         skin/classic/aero/browser/menu-back.png                      (menu-back-aero.png)
         skin/classic/aero/browser/menu-forward.png                   (menu-forward-aero.png)
         skin/classic/aero/browser/navbar-textbox-buttons.png         (navbar-textbox-buttons-aero.png)
+        skin/classic/aero/browser/urlbar-favicon-glow.png
         skin/classic/aero/browser/feeds/feed-icons-16.png            (feeds/feed-icons-16-aero.png)
         skin/classic/aero/browser/feeds/feedIcon.png                 (feeds/feedIcon-aero.png)
         skin/classic/aero/browser/feeds/feedIcon16.png               (feeds/feedIcon16-aero.png)
         skin/classic/aero/browser/feeds/audioFeedIcon.png            (feeds/audioFeedIcon-aero.png)
         skin/classic/aero/browser/feeds/audioFeedIcon16.png          (feeds/audioFeedIcon16-aero.png)
         skin/classic/aero/browser/feeds/videoFeedIcon.png            (feeds/videoFeedIcon-aero.png)
         skin/classic/aero/browser/feeds/videoFeedIcon16.png          (feeds/videoFeedIcon16-aero.png)
         skin/classic/aero/browser/feeds/subscribe.css                (feeds/subscribe.css)
--- a/browser/themes/winstripe/browser/places/places.css
+++ b/browser/themes/winstripe/browser/places/places.css
@@ -44,17 +44,17 @@ treechildren::-moz-tree-image(title, con
   -moz-image-region: rect(0px, 32px, 16px, 16px);
 treechildren::-moz-tree-image(title, open) {
   -moz-image-region: rect(16px, 32px, 32px, 16px);
 treechildren::-moz-tree-image(title, container, livemark) {
-  list-style-image: url("chrome://browser/skin/page-livemarks.png");
+  list-style-image: url("chrome://browser/skin/livemark-folder.png");
   -moz-image-region: auto;
 treechildren::-moz-tree-image(container, OrganizerQuery_AllBookmarks) {
   list-style-image: url("chrome://browser/skin/places/allBookmarks.png");
   -moz-image-region: auto;
@@ -63,30 +63,37 @@ treechildren::-moz-tree-image(container,
   -moz-image-region: auto;
 treechildren::-moz-tree-image(container, OrganizerQuery_BookmarksMenu) {
   list-style-image: url("chrome://browser/skin/places/bookmarksMenu.png");
   -moz-image-region: auto;
+treechildren::-moz-tree-image(container, OrganizerQuery_UnfiledBookmarks) {
+  list-style-image: url("chrome://browser/skin/places/unsortedBookmarks.png");
+  -moz-image-region: auto;
 /* query-nodes should be styled even if they're not expandable */
 treechildren::-moz-tree-image(title, query) {
   list-style-image: url("chrome://browser/skin/places/query.png");
   -moz-image-region: auto;
-treechildren::-moz-tree-image(title, query, tagContainer) {
+treechildren::-moz-tree-image(title, query, tagContainer),
+treechildren::-moz-tree-image(container, OrganizerQuery_Tags) {
   list-style-image: url("chrome://mozapps/skin/places/tagContainerIcon.png");
   -moz-image-region: auto;
+/* calendar icon for folders grouping items by date */
 treechildren::-moz-tree-image(title, query, dayContainer) {
-  list-style-image: url("chrome://global/skin/icons/folder-item.png");
-  -moz-image-region: rect(0px, 32px, 16px, 16px);
+  list-style-image: url("chrome://browser/skin/places/calendar.png");
+  -moz-image-region: auto;
 treechildren::-moz-tree-image(title, query, hostContainer) {
   list-style-image: url("chrome://global/skin/icons/folder-item.png");
   -moz-image-region: rect(0px, 32px, 16px, 16px);
 treechildren::-moz-tree-image(title, query, hostContainer, open) {
new file mode 100644
index e69de29bb2d1d6434b8b29ae775ad8c2e48c5391..19de6ff972550759b8eedb5b2caf6146d599973f
GIT binary patch
literal 619
--- a/
+++ b/
@@ -1,11 +1,11 @@
 NSS_CO_TAG  = 'NSS_3_12_RC2'
 NSPR_DIRS = ('nsprpub',)
 NSS_DIRS  = ('dbm',
--- a/content/base/src/nsContentUtils.cpp
+++ b/content/base/src/nsContentUtils.cpp
@@ -4017,16 +4017,27 @@ nsContentUtils::DOMEventToNativeKeyEvent
   aNativeEvent->nativeEvent = GetNativeEvent(aDOMEvent);
   return PR_TRUE;
+static PRBool
+HasASCIIDigit(const nsTArray<nsShortcutCandidate>& aCandidates)
+  for (PRUint32 i = 0; i < aCandidates.Length(); ++i) {
+    PRUint32 ch = aCandidates[i].mCharCode;
+    if (ch >= '0' && ch <= '9')
+      return PR_TRUE;
+  }
+  return PR_FALSE;
 /* static */
 nsContentUtils::GetAccelKeyCandidates(nsIDOMEvent* aDOMEvent,
                   nsTArray<nsShortcutCandidate>& aCandidates)
   NS_PRECONDITION(aCandidates.IsEmpty(), "aCandidates must be empty");
   nsAutoString eventType;
@@ -4049,30 +4060,44 @@ nsContentUtils::GetAccelKeyCandidates(ns
     //   0: charCode/PR_FALSE,
     //   1: shiftedCharCodes[0]/PR_FALSE, 2: shiftedCharCodes[0]/PR_TRUE,
     //   3: shiftedCharCodes[1]/PR_FALSE, 4: shiftedCharCodes[1]/PR_TRUE...
     if (nativeKeyEvent->charCode) {
       nsShortcutCandidate key(nativeKeyEvent->charCode, PR_FALSE);
+    PRUint32 len = nativeKeyEvent->alternativeCharCodes.Length();
     if (!nativeKeyEvent->isShift) {
-      for (PRUint32 i = 0;
-           i < nativeKeyEvent->alternativeCharCodes.Length(); ++i) {
+      for (PRUint32 i = 0; i < len; ++i) {
         PRUint32 ch =
         if (!ch || ch == nativeKeyEvent->charCode)
         nsShortcutCandidate key(ch, PR_FALSE);
+      // If unshiftedCharCodes doesn't have numeric but shiftedCharCode has it,
+      // this keyboard layout is AZERTY or similar layout, probably.
+      // In this case, Accel+[0-9] should be accessible without shift key.
+      // However, the priority should be lowest.
+      if (!HasASCIIDigit(aCandidates)) {
+        for (PRUint32 i = 0; i < len; ++i) {
+          PRUint32 ch =
+            nativeKeyEvent->alternativeCharCodes[i].mShiftedCharCode;
+          if (ch >= '0' && ch <= '9') {
+            nsShortcutCandidate key(ch, PR_FALSE);
+            aCandidates.AppendElement(key);
+            break;
+          }
+        }
+      }
     } else {
-      for (PRUint32 i = 0;
-           i < nativeKeyEvent->alternativeCharCodes.Length(); ++i) {
+      for (PRUint32 i = 0; i < len; ++i) {
         PRUint32 ch = nativeKeyEvent->alternativeCharCodes[i].mShiftedCharCode;
         if (!ch)
         if (ch != nativeKeyEvent->charCode) {
           nsShortcutCandidate key(ch, PR_FALSE);
--- a/content/base/src/nsGkAtomList.h
+++ b/content/base/src/nsGkAtomList.h
@@ -74,16 +74,17 @@ GK_ATOM(above, "above")
 GK_ATOM(absoluteList, "Absolute-list")
 GK_ATOM(acceltext, "acceltext")
 GK_ATOM(accept, "accept")
 GK_ATOM(acceptcharset, "accept-charset")
 GK_ATOM(accesskey, "accesskey")
 GK_ATOM(acronym, "acronym")
 GK_ATOM(action, "action")
 GK_ATOM(active, "active")
+GK_ATOM(activetitlebarcolor, "activetitlebarcolor")
 GK_ATOM(actuate, "actuate")
 GK_ATOM(address, "address")
 GK_ATOM(after, "after")
 GK_ATOM(after_end, "after_end")
 GK_ATOM(after_start, "after_start")
 GK_ATOM(align, "align")
 GK_ATOM(alink, "alink")
 GK_ATOM(all, "all")
@@ -400,16 +401,17 @@ GK_ATOM(ignorecase, "ignorecase")
 GK_ATOM(ignorekeys, "ignorekeys")
 GK_ATOM(ilayer, "ilayer")
 GK_ATOM(image, "image")
 GK_ATOM(imageClickedPoint, "image-clicked-point")
 GK_ATOM(img, "img")
 GK_ATOM(implementation, "implementation")
 GK_ATOM(implements, "implements")
 GK_ATOM(import, "import")
+GK_ATOM(inactivetitlebarcolor, "inactivetitlebarcolor")
 GK_ATOM(include, "include")
 GK_ATOM(includes, "includes")
 GK_ATOM(increment, "increment")
 GK_ATOM(indent, "indent")
 GK_ATOM(index, "index")
 GK_ATOM(infer, "infer")
 GK_ATOM(infinity, "infinity")
 GK_ATOM(inherit, "inherit")
@@ -837,17 +839,16 @@ GK_ATOM(textarea, "textarea")
 GK_ATOM(textbox, "textbox")
 GK_ATOM(textnode, "textnode")
 GK_ATOM(tfoot, "tfoot")
 GK_ATOM(th, "th")
 GK_ATOM(thead, "thead")
 GK_ATOM(thumb, "thumb")
 GK_ATOM(title, "title")
 GK_ATOM(titlebar, "titlebar")
-GK_ATOM(titlebarcolor, "titlebarcolor")
 GK_ATOM(titletip, "titletip")
 GK_ATOM(toggled, "toggled")
 GK_ATOM(token, "token")
 GK_ATOM(tokenize, "tokenize")
 GK_ATOM(toolbar, "toolbar")
 GK_ATOM(toolbarbutton, "toolbarbutton")
 GK_ATOM(toolbaritem, "toolbaritem")
 GK_ATOM(toolbox, "toolbox")
--- a/content/base/src/nsHTMLContentSerializer.cpp
+++ b/content/base/src/nsHTMLContentSerializer.cpp
@@ -752,18 +752,16 @@ nsHTMLContentSerializer::AppendElementSt
     for (i = 0; i < childCount; ++i) {
       nsIContent* child = content->GetChildAt(i);
       if (child->IsNodeOfType(nsINode::eHTML) &&
           child->Tag() == nsGkAtoms::meta &&
           child->HasAttr(kNameSpaceID_None, nsGkAtoms::content)) {
         nsAutoString header;
         child->GetAttr(kNameSpaceID_None, nsGkAtoms::httpEquiv, header);
-        printf("Header value = '%s'\n", NS_ConvertUTF16toUTF8(header).get());
         if (header.LowerCaseEqualsLiteral("content-type")) {
           hasMeta = PR_TRUE;
     if (!hasMeta) {
--- a/content/html/document/src/nsHTMLDocument.cpp
+++ b/content/html/document/src/nsHTMLDocument.cpp
@@ -3966,16 +3966,20 @@ nsHTMLDocument::SetEditingState(EditingS
   mEditingState = aState;
   return NS_OK;
+  if (mRemovedFromDocShell) {
+    return NS_OK;
+  }
   if (mEditingState == eSettingUp || mEditingState == eTearingDown) {
     // XXX We shouldn't recurse.
     return NS_OK;
   PRBool designMode = HasFlag(NODE_IS_EDITABLE);
   EditingState newState = designMode ? eDesignMode :
                           (mContentEditableCount > 0 ? eContentEditable : eOff);
--- a/content/xul/content/src/nsXULElement.cpp
+++ b/content/xul/content/src/nsXULElement.cpp
@@ -1138,27 +1138,28 @@ nsXULElement::AfterSetAttr(PRInt32 aName
         // Hide chrome if needed
         if (aName == nsGkAtoms::hidechrome &&
             mNodeInfo->Equals(nsGkAtoms::window) &&
             aValue) {
             HideWindowChrome(aValue && NS_LITERAL_STRING("true").Equals(*aValue));
-        // titlebarcolor is settable on any root node (windows, dialogs, etc)
+        // (in)activetitlebarcolor is settable on any root node (windows, dialogs, etc)
         nsIDocument *document = GetCurrentDoc();
-        if (aName == nsGkAtoms::titlebarcolor &&
+        if ((aName == nsGkAtoms::activetitlebarcolor ||
+             aName == nsGkAtoms::inactivetitlebarcolor) &&
             document && document->GetRootContent() == this) {
             nscolor color = NS_RGBA(0, 0, 0, 0);
             nsAttrValue attrValue;
             attrValue.ParseColor(*aValue, document);
-            SetTitlebarColor(color);
+            SetTitlebarColor(color, aName == nsGkAtoms::activetitlebarcolor);
         if (aName == nsGkAtoms::src && document) {
         // XXX need to check if they're changing an event handler: if
         // so, then we need to unhook the old one.  Or something.
@@ -1391,20 +1392,21 @@ nsXULElement::UnsetAttr(PRInt32 aNameSpa
     // XXX Know how to remove POPUP event listeners when an attribute is unset?
     if (aNameSpaceID == kNameSpaceID_None) {
         if (aName == nsGkAtoms::hidechrome &&
             mNodeInfo->Equals(nsGkAtoms::window)) {
-        if (aName == nsGkAtoms::titlebarcolor &&
+        if ((aName == nsGkAtoms::activetitlebarcolor ||
+             aName == nsGkAtoms::inactivetitlebarcolor) &&
             doc && doc->GetRootContent() == this) {
             // Use 0, 0, 0, 0 as the "none" color.
-            SetTitlebarColor(NS_RGBA(0, 0, 0, 0));
+            SetTitlebarColor(NS_RGBA(0, 0, 0, 0), aName == nsGkAtoms::activetitlebarcolor);
         // If the accesskey attribute is removed, unregister it here
         // Also see nsAreaFrame, nsBoxFrame and nsTextBoxFrame's AttributeChanged
         if (aName == nsGkAtoms::accesskey || aName == nsGkAtoms::control) {
@@ -2448,32 +2450,32 @@ nsXULElement::HideWindowChrome(PRBool aS
     return NS_OK;
-nsXULElement::SetTitlebarColor(nscolor aColor)
+nsXULElement::SetTitlebarColor(nscolor aColor, PRBool aActive)
     nsIDocument* doc = GetCurrentDoc();
     if (!doc || doc->GetRootContent() != this) {
     // only top level chrome documents can set the titlebar color
     if (!doc->GetParentDocument()) {
         nsCOMPtr<nsISupports> container = doc->GetContainer();
         nsCOMPtr<nsIBaseWindow> baseWindow = do_QueryInterface(container);
         if (baseWindow) {
             nsCOMPtr<nsIWidget> mainWidget;
             if (mainWidget) {
-                mainWidget->SetWindowTitlebarColor(aColor);
+                mainWidget->SetWindowTitlebarColor(aColor, aActive);
 nsXULElement::BoolAttrIsTrue(nsIAtom* aName)
--- a/content/xul/content/src/nsXULElement.h
+++ b/content/xul/content/src/nsXULElement.h
@@ -721,17 +721,17 @@ protected:
     void AddListenerFor(const nsAttrName& aName,
                         PRBool aCompileEventHandlers);
     void MaybeAddPopupListener(nsIAtom* aLocalName);
     nsresult HideWindowChrome(PRBool aShouldHide);
-    void SetTitlebarColor(nscolor aColor);
+    void SetTitlebarColor(nscolor aColor, PRBool aActive);
     const nsAttrName* InternalGetExistingAttrNameFromQName(const nsAString& aStr) const;
     void RemoveBroadcaster(const nsAString & broadcasterId);
     // Internal accessor. This shadows the 'Slots', and returns
     // appropriate value.
--- a/docshell/base/nsDocShell.cpp
+++ b/docshell/base/nsDocShell.cpp
@@ -1006,22 +1006,19 @@ nsDocShell::FirePageHideNotification(PRB
         n = kids.Length();
         for (i = 0; i < n; ++i) {
             if (kids[i]) {
-    }
-    // Now make sure our editor, if any, is detached before we go
-    // any farther.
-    if (mEditorData && aIsUnload) {
-      DetachEditorFromWindow();
+        // Now make sure our editor, if any, is detached before we go
+        // any farther.
+        DetachEditorFromWindow();
     return NS_OK;
 // Bug 13871: Prevent frameset spoofing
@@ -3031,16 +3028,22 @@ nsDocShell::DisplayLoadError(nsresult aE
             // No channel, let's obtain the generic error message
             if (nsserr) {
                 nsserr->GetErrorMessage(aError, messageStr);
         if (!messageStr.IsEmpty()) {
             if (errorClass == nsINSSErrorsService::ERROR_CLASS_BAD_CERT) {
+                PRBool expert = PR_FALSE;
+                mPrefs->GetBoolPref("browser.xul.error_pages.expert_bad_cert",
+                                    &expert);
+                if (expert) {
+                    cssClass.AssignLiteral("expertBadCert");
+                }
             } else {
     } else if (NS_ERROR_PHISHING_URI == aError || NS_ERROR_MALWARE_URI == aError) {
         nsCAutoString host;
         CopyUTF8toUTF16(host, formatStrs[0]);
@@ -3366,21 +3369,16 @@ nsDocShell::Reload(PRUint32 aReloadFlags
                           loadType,       // Load type
                           nsnull,         // No SHEntry
                           nsnull,         // No nsIDocShell
                           nsnull);        // No nsIRequest
-    // Need to purge detached editor here, else when we reload a page,
-    // the detached editor state causes SetDesignMode() to fail.
-    if (mOSHE)
-      mOSHE->SetEditorData(nsnull);
     return rv;
 nsDocShell::Stop(PRUint32 aStopFlags)
     // Revoke any pending event related to content viewer restoration
@@ -4874,18 +4872,23 @@ nsDocShell::Embed(nsIContentViewer * aCo
         mLoadType == LOAD_RELOAD_CHARSET_CHANGE)){
         PRBool isWyciwyg = PR_FALSE;
         // Check if the url is wyciwyg
         rv = mCurrentURI->SchemeIs("wyciwyg", &isWyciwyg);      
         if (isWyciwyg && NS_SUCCEEDED(rv))
     // XXX What if SetupNewViewer fails?
-    if (mLSHE)
+    if (mLSHE) {
+        // Restore the editing state, if it's stored in session history.
+        if (mLSHE->HasDetachedEditor()) {
+            ReattachEditorToWindow(mLSHE);
+        }
         SetHistoryEntry(&mOSHE, mLSHE);
+    }
     PRBool updateHistory = PR_TRUE;
     // Determine if this type of load should update history
     switch (mLoadType) {
@@ -5321,75 +5324,70 @@ nsDocShell::CanSavePresentation(PRUint32
     // If the document does not want its presentation cached, then don't.
     nsCOMPtr<nsIDocument> doc = do_QueryInterface(pWin->GetExtantDocument());
     if (!doc || !doc->CanSavePresentation(aNewRequest))
         return PR_FALSE;
     return PR_TRUE;
-  return (mOSHE && mOSHE->HasDetachedEditor()) ||
-         (mLSHE && mLSHE->HasDetachedEditor());
-nsDocShell::ReattachEditorToWindow(nsIDOMWindow *aWindow, nsISHEntry *aSHEntry)
+nsDocShell::ReattachEditorToWindow(nsISHEntry *aSHEntry)
                  "Why reattach an editor when we already have one?");
-    NS_ASSERTION(aWindow,
-                 "Need a window to reattach to.");
-    NS_ASSERTION(HasDetachedEditor(),
+    NS_ASSERTION(aSHEntry && aSHEntry->HasDetachedEditor(),
                  "Reattaching when there's not a detached editor.");
-    if (mEditorData || !aWindow || !aSHEntry)
+    if (mEditorData || !aSHEntry)
     mEditorData = aSHEntry->ForgetEditorData();
     if (mEditorData) {
-        nsresult res = mEditorData->ReattachToWindow(aWindow);
+        nsresult res = mEditorData->ReattachToWindow(this);
         NS_ASSERTION(NS_SUCCEEDED(res), "Failed to reattach editing session");
 nsDocShell::DetachEditorFromWindow(nsISHEntry *aSHEntry)
-    if (!aSHEntry || !mEditorData)
+    if (!mEditorData)
-    NS_ASSERTION(!aSHEntry->HasDetachedEditor(),
-                 "Why detach an editor twice?");
+    NS_ASSERTION(!aSHEntry || !aSHEntry->HasDetachedEditor(),
+                 "Detaching editor when it's already detached.");
     nsresult res = mEditorData->DetachFromWindow();
     NS_ASSERTION(NS_SUCCEEDED(res), "Failed to detach editor");
     if (NS_SUCCEEDED(res)) {
-      // Make aSHEntry hold the owning ref to the editor data.
-      aSHEntry->SetEditorData(mEditorData.forget());
+        // Make aSHEntry hold the owning ref to the editor data.
+        if (aSHEntry)
+            aSHEntry->SetEditorData(mEditorData.forget());
+        else
+            mEditorData = nsnull;
 #ifdef DEBUG
         PRBool isEditable;
                      "Window is still editable after detaching editor.");
 #endif // DEBUG
-    DetachEditorFromWindow(mOSHE);
+    if (mOSHE)
+        DetachEditorFromWindow(mOSHE);
     if (!mOSHE || mOSHE == mLSHE) {
         // No entry to save into, or we're replacing the existing entry.
         return NS_ERROR_FAILURE;
@@ -5531,16 +5529,20 @@ nsDocShell::FinishRestore()
     PRInt32 n = mChildList.Count();
     for (PRInt32 i = 0; i < n; ++i) {
         nsCOMPtr<nsIDocShell> child = do_QueryInterface(ChildAt(i));
         if (child) {
+    if (mOSHE && mOSHE->HasDetachedEditor()) {
+      ReattachEditorToWindow(mOSHE);
+    }
     if (mContentViewer) {
         nsCOMPtr<nsIDOMDocument> domDoc;
         nsCOMPtr<nsIDocument> doc = do_QueryInterface(domDoc);
         if (doc) {
             // Finally, we remove the request from the loadgroup.  This will
             // cause onStateChange(STATE_STOP) to fire, which will fire the
@@ -5999,21 +6001,16 @@ nsDocShell::RestoreFromHistory()
                    newBounds.y, newBounds.width, newBounds.height);
             widget->Resize(newBounds.x, newBounds.y, newBounds.width,
                            newBounds.height, PR_FALSE);
-    if (HasDetachedEditor()) {
-      nsCOMPtr<nsIDOMWindow> domWin = do_QueryInterface(privWin);
-      ReattachEditorToWindow(domWin, mLSHE);
-    }
     // Simulate the completion of the load.
     // Restart plugins, and paint the content.
     if (shell)
     return privWin->FireDelayedDOMEvents();
@@ -7142,20 +7139,16 @@ nsDocShell::InternalLoad(nsIURI * aURI,
         if (NS_FAILED(rv)) 
             return rv;
     mLoadType = aLoadType;
-    // Detach the current editor so that it can be restored from the
-    // bfcache later.
-    DetachEditorFromWindow();
     // mLSHE should be assigned to aSHEntry, only after Stop() has
     // been called. But when loading an error page, do not clear the
     // mLSHE for the real page.
     if (mLoadType != LOAD_ERROR_PAGE)
         SetHistoryEntry(&mLSHE, aSHEntry);
     mSavingOldViewer = savePresentation;
@@ -7209,32 +7202,16 @@ nsDocShell::InternalLoad(nsIURI * aURI,
                    (aFlags & INTERNAL_LOAD_FLAGS_BYPASS_CLASSIFIER) != 0);
     if (req && aRequest)
         NS_ADDREF(*aRequest = req);
     if (NS_FAILED(rv)) {
         nsCOMPtr<nsIChannel> chan(do_QueryInterface(req));
         DisplayLoadError(rv, aURI, nsnull, chan);
-    if (aSHEntry) {
-        if (aLoadType & LOAD_CMD_HISTORY) {
-            // We've just loaded a page from session history. Reattach
-            // its editing session if it has one.
-            nsCOMPtr<nsIDOMWindow> domWin;
-            CallGetInterface(this, static_cast<nsIDOMWindow**>(getter_AddRefs(domWin)));
-            ReattachEditorToWindow(domWin, aSHEntry);
-        } else {
-            // This is a non-history load from a session history entry. Purge any
-            // previous editing sessions, so that the the editing session will
-            // be recreated. This can happen when we reload something that's
-            // in the bfcache.
-            aSHEntry->SetEditorData(nsnull);
-        }
-    }
     return rv;
 nsDocShell::GetInheritedPrincipal(PRBool aConsiderCurrentDocument)
     nsCOMPtr<nsIDocument> document;
@@ -8724,19 +8701,22 @@ nsDocShell::ShouldDiscardLayoutState(nsI
 // nsDocShell: nsIEditorDocShell
 NS_IMETHODIMP nsDocShell::GetEditor(nsIEditor * *aEditor)
-  nsresult rv = EnsureEditorData();
-  if (NS_FAILED(rv)) return rv;
+  if (!mEditorData) {
+    *aEditor = nsnull;
+    return NS_OK;
+  }
   return mEditorData->GetEditor(aEditor);
 NS_IMETHODIMP nsDocShell::SetEditor(nsIEditor * aEditor)
   nsresult rv = EnsureEditorData();
   if (NS_FAILED(rv)) return rv;
@@ -9032,19 +9012,22 @@ nsDocShell::EnsureScriptEnvironment()
     return NS_OK;
-    NS_ASSERTION(!HasDetachedEditor(), "EnsureEditorData() called when detached.\n");
-    if (!mEditorData && !mIsBeingDestroyed && !HasDetachedEditor()) {
+    PRBool openDocHasDetachedEditor = mOSHE && mOSHE->HasDetachedEditor();
+    if (!mEditorData && !mIsBeingDestroyed && !openDocHasDetachedEditor) {
+        // We shouldn't recreate the editor data if it already exists, or
+        // we're shutting down, or we already have a detached editor data
+        // stored in the session history. We should only have one editordata
+        // per docshell.
         mEditorData = new nsDocShellEditorData(this);
     return mEditorData ? NS_OK : NS_ERROR_NOT_AVAILABLE;
--- a/docshell/base/nsDocShell.h
+++ b/docshell/base/nsDocShell.h
@@ -520,17 +520,17 @@ protected:
     // Check whether aURI is about:blank
     static PRBool IsAboutBlank(nsIURI* aURI);
     // Call this when a URI load is handed to us (via OnLinkClick or
     // InternalLoad).  This makes sure that we're not inside unload, or that if
     // we are it's still OK to load this URI.
     PRBool IsOKToLoadURI(nsIURI* aURI);
-    void ReattachEditorToWindow(nsIDOMWindow *aWindow, nsISHEntry *aSHEntry);
+    void ReattachEditorToWindow(nsISHEntry *aSHEntry);
     void DetachEditorFromWindow(nsISHEntry *aSHEntry);
     // Override the parent setter from nsDocLoader
     virtual nsresult SetDocLoaderParent(nsDocLoader * aLoader);
     // Event type dispatched by RestorePresentation
     class RestorePresentationEvent : public nsRunnable {
@@ -672,20 +672,16 @@ protected:
     nsPIDOMEventTarget *       mChromeEventHandler; //Weak Reference
 #ifdef DEBUG
     PRBool mInEnsureScriptEnv;
     static nsIURIFixup *sURIFixup;
-    // Returns true when the currently open document has a detached editor
-    // waiting to be reattached.
-    PRBool HasDetachedEditor();
     class InterfaceRequestorProxy : public nsIInterfaceRequestor {
         InterfaceRequestorProxy(nsIInterfaceRequestor* p);
         virtual ~InterfaceRequestorProxy();
--- a/docshell/base/nsDocShellEditorData.cpp
+++ b/docshell/base/nsDocShellEditorData.cpp
@@ -68,22 +68,22 @@ nsDocShellEditorData::nsDocShellEditorDa
-  NS_ASSERTION(mIsDetached, "We should be detached before tearing down");
   if (mEditor) {
     mEditor = nsnull;
   mEditingSession = nsnull;
+  mIsDetached = PR_FALSE;
@@ -239,22 +239,26 @@ nsDocShellEditorData::DetachFromWindow()
   mMakeEditable = PR_FALSE;
   nsCOMPtr<nsIDOMDocument> domDoc;
   nsCOMPtr<nsIHTMLDocument> htmlDoc = do_QueryInterface(domDoc);
   if (htmlDoc)
     mDetachedEditingState = htmlDoc->GetEditingState();
+  mDocShell = nsnull;
   return NS_OK;
-nsDocShellEditorData::ReattachToWindow(nsIDOMWindow *aWindow)
+nsDocShellEditorData::ReattachToWindow(nsIDocShell* aDocShell)
+  mDocShell = aDocShell;
   nsCOMPtr<nsIDOMWindow> domWindow = do_GetInterface(mDocShell);
   nsresult rv = mEditingSession->ReattachToWindow(domWindow);
   mIsDetached = PR_FALSE;
   mMakeEditable = mDetachedMakeEditable;
   nsCOMPtr<nsIDOMDocument> domDoc;
--- a/docshell/base/nsDocShellEditorData.h
+++ b/docshell/base/nsDocShellEditorData.h
@@ -67,17 +67,17 @@ public:
   nsresult MakeEditable(PRBool inWaitForUriLoad);
   PRBool GetEditable();
   nsresult CreateEditor();
   nsresult GetEditingSession(nsIEditingSession **outEditingSession);
   nsresult GetEditor(nsIEditor **outEditor);
   nsresult SetEditor(nsIEditor *inEditor);
   void TearDownEditor();
   nsresult DetachFromWindow();
-  nsresult ReattachToWindow(nsIDOMWindow *aWindow);
+  nsresult ReattachToWindow(nsIDocShell *aDocShell);
   nsresult EnsureEditingSession();
   // The doc shell that owns us. Weak ref, since it always outlives us.  
   nsIDocShell* mDocShell;
--- a/docshell/base/nsIDocShell.idl
+++ b/docshell/base/nsIDocShell.idl
@@ -63,17 +63,17 @@ interface nsIWebNavigation;
 interface nsISimpleEnumerator;
 interface nsIInputStream;
 interface nsIRequest;
 interface nsISHEntry;
 interface nsILayoutHistoryState;
 interface nsISecureBrowserUI;
 interface nsIDOMStorage;
-[scriptable, uuid(4b00222a-8d0a-46d7-a1fe-43bd89d19324)]
+[scriptable, uuid(7d1cf6b9-daa3-476d-8f9f-9eb2a971a95c)]
 interface nsIDocShell : nsISupports
    * Loads a given URI.  This will give priority to loading the requested URI
    * in the object implementing	this interface.  If it can't be loaded here
    * however, the URL dispatcher will go through its normal process of content
    * loading.
--- a/docshell/resources/content/netError.xhtml
+++ b/docshell/resources/content/netError.xhtml
@@ -158,30 +158,34 @@
  = "errorLongDesc";
         // remove undisplayed errors to avoid bug 39098
         var errContainer = document.getElementById("errorContainer");
         var className = getCSSClass();
-        if (className) {
+        if (className && className != "expertBadCert") {
           // Associate a CSS class with the root of the page, if one was passed in,
           // to allow custom styling.
+          // Not "expertBadCert" though, don't want to deal with the favicon
           document.documentElement.className = className;
           // Also, if they specified a CSS class, they must supply their own
           // favicon.  In order to trigger the browser to repaint though, we
           // need to remove/add the link element. 
           var favicon = document.getElementById("favicon");
           var faviconParent = favicon.parentNode;
           favicon.setAttribute("href", "chrome://global/skin/icons/" + className + "_favicon.png");
+        if (className == "expertBadCert") {
+          showSecuritySection();
+        }
         if (err == "nssBadCert") {
           // Remove the "Try again" button for security exceptions, since it's
           // almost certainly useless.
           document.getElementById("errorTryAgain").style.display = "none";
           document.getElementById("errorPageContainer").setAttribute("class", "certerror");
--- a/docshell/shistory/public/nsISHEntry.idl
+++ b/docshell/shistory/public/nsISHEntry.idl
@@ -53,17 +53,17 @@ interface nsISupportsArray;
 struct nsRect;
 class nsDocShellEditorData;
 [ref] native nsRect(nsRect);
 [ptr] native nsDocShellEditorDataPtr(nsDocShellEditorData);
-[scriptable, uuid(abe54136-49e5-44ca-a749-290038c6b85d)]
+[scriptable, uuid(c16fde76-3108-450e-8c8c-ae8286f286ed)]
 interface nsISHEntry : nsIHistoryEntry
     /** URI for the document */
     void setURI(in nsIURI aURI);
     /** Referrer URI */
     attribute nsIURI referrerURI;
--- a/docshell/test/browser/
+++ b/docshell/test/browser/
@@ -39,18 +39,24 @@ topsrcdir	= @top_srcdir@
 srcdir		= @srcdir@
 VPATH		= @srcdir@
 relativesrcdir	= docshell/test/browser 
 include $(DEPTH)/config/
 include $(topsrcdir)/config/
-		browser_bug92473.js \
-		test-form_sjis.html \
-		browser_bug134911.js \
 		browser_bug349769.js \
 		browser_bug388121-1.js \
 		browser_bug388121-2.js \
+# the tests below use FUEL, which is a Firefox-specific feature
+		browser_bug92473.js \
+		test-form_sjis.html \
+		browser_bug134911.js \
+		$(NULL)
 	$(INSTALL) $(foreach f,$^,"$f") $(DEPTH)/_tests/testing/mochitest/browser/$(relativesrcdir)
--- a/docshell/test/navigation/
+++ b/docshell/test/navigation/
@@ -45,16 +45,17 @@ include $(DEPTH)/config/
 include $(topsrcdir)/config/
 		test_bug13871.html \
 		test_bug270414.html \
 		test_bug278916.html \
 		test_bug279495.html \
 		test_bug386782.html \
+ 		test_bug430624.html \
 		test_bug430723.html \
 		test_child.html \
 		test_grandchild.html \
 		test_sibling-off-domain.html \
 		test_sibling-matching-parent.html \
 		test_opener.html \
 		test_not-opener.html \
 		test_popup-navigates-children.html \
new file mode 100644
--- /dev/null
+++ b/docshell/test/navigation/test_bug430624.html
@@ -0,0 +1,55 @@
+  <title>Test for Bug 430624</title>
+  <script type="text/javascript" src="/MochiKit/MochiKit.js"></script>
+  <script type="text/javascript" src="/tests/SimpleTest/SimpleTest.js"></script>
+  <link rel="stylesheet" type="text/css" href="/tests/SimpleTest/test.css" />
+  <script type="text/javascript" src="/tests/SimpleTest/EventUtils.js"></script>  
+<a target="_blank" href="">Mozilla Bug 430624</a>
+<p id="display"></p>
+<div id="content" style="display: none">
+<pre id="test">
+<script class="testbody" type="text/javascript">
+/** Test for Bug 430624 **/
+function onLoad() {
+  window.frames[0].frameElement.onload = onReload;
+  window.frames[0].location = window.frames[0].location;
+function onReload() {
+  var bodyElement = window.frames[0].frameElement.contentDocument.body;
+  sendChar('S', bodyElement);
+  sendChar('t', bodyElement);
+  sendChar('i', bodyElement);
+  sendChar('l', bodyElement);
+  sendChar('l', bodyElement);
+  sendChar(' ', bodyElement);
+  is(bodyElement.innerHTML, "Still contentEditable", "Check we're contentEditable after reload");
+  SimpleTest.finish();
+<iframe onload="onLoad()" src="data:text/html;charset=utf-8,<body contenteditable>contentEditable</body>"></iframe>
--- a/dom/src/base/nsGlobalWindow.cpp
+++ b/dom/src/base/nsGlobalWindow.cpp
@@ -2218,30 +2218,75 @@ nsGlobalWindow::PostHandleEvent(nsEventC
   NS_PRECONDITION(IsInnerWindow(), "PostHandleEvent is used on outer window!?");
   /* mChromeEventHandler and mContext go dangling in the middle of this
    function under some circumstances (events that destroy the window)
    without this addref. */
   nsCOMPtr<nsPIDOMEventTarget> kungFuDeathGrip1(mChromeEventHandler);
   nsCOMPtr<nsIScriptContext> kungFuDeathGrip2(GetContextInternal());
   nsGlobalWindow* outer = GetOuterWindowInternal();
-  // if the window is deactivated while in full screen mode,
-  // restore OS chrome, and hide it again upon re-activation
-  if (outer && outer->mFullScreen) {
-    if (aVisitor.mEvent->message == NS_DEACTIVATE ||
-        aVisitor.mEvent->message == NS_ACTIVATE) {
+  if (aVisitor.mEvent->message == NS_DEACTIVATE ||
+      aVisitor.mEvent->message == NS_ACTIVATE) {
+    // if the window is deactivated while in full screen mode,
+    // restore OS chrome, and hide it again upon re-activation
+    if (outer && outer->mFullScreen) {
       nsCOMPtr<nsIFullScreen> fullScreen =
       if (fullScreen) {
         if (aVisitor.mEvent->message == NS_DEACTIVATE)
+    // Set / unset the "active" attribute on the documentElement
+    // of the top level window
+    nsCOMPtr<nsIWidget> mainWidget = GetMainWidget();
+    NS_ENSURE_TRUE(mainWidget, nsnull);
+    // Get the top level widget (if the main widget is a sheet, this will
+    // be the sheet's top (non-sheet) parent).
+    nsCOMPtr<nsIWidget> topLevelWidget = mainWidget->GetSheetWindowParent();
+    if (!topLevelWidget)
+      topLevelWidget = mainWidget;
+    // Get the top level widget's nsGlobalWindow
+    nsCOMPtr<nsIDOMWindowInternal> topLevelWindow;
+    if (topLevelWidget == mainWidget) {
+      topLevelWindow = static_cast<nsIDOMWindowInternal *>(this);
+    } else {
+      // This is a workaround for the following problem:
+      // When a window with an open sheet loses focus, only the sheet window
+      // receives the NS_DEACTIVATE event. However, it's not the sheet that
+      // should lose the "active" attribute, but the containing top level window.
+      void* clientData;
+      topLevelWidget->GetClientData(clientData); // clientData is nsXULWindow
+      nsISupports* data = static_cast<nsISupports*>(clientData);
+      nsCOMPtr<nsIInterfaceRequestor> req(do_QueryInterface(data));
+      topLevelWindow = do_GetInterface(req);
+    }
+    if (topLevelWindow) {
+      // Only set the attribute if the document is a XUL document and the
+      // window is a chrome window
+      nsCOMPtr<nsIDOMDocument> domDoc;
+      topLevelWindow->GetDocument(getter_AddRefs(domDoc));
+      nsCOMPtr<nsIDocument> doc(do_QueryInterface(domDoc));
+      nsCOMPtr<nsIDOMXULDocument> xulDoc(do_QueryInterface(doc));
+      nsCOMPtr<nsIDOMChromeWindow> chromeWin = do_QueryInterface(topLevelWindow);
+      if (xulDoc && chromeWin) {
+        nsCOMPtr<nsIContent> rootElem = doc->GetRootContent();
+        if (aVisitor.mEvent->message == NS_ACTIVATE)
+          rootElem->SetAttr(kNameSpaceID_None, nsGkAtoms::active,
+                            NS_LITERAL_STRING("true"), PR_TRUE);
+        else
+          rootElem->UnsetAttr(kNameSpaceID_None, nsGkAtoms::active, PR_TRUE);
+      }
+    }
   if (aVisitor.mEvent->message == NS_RESIZE_EVENT) {
     mIsHandlingResizeEvent = PR_FALSE;
   } else if (aVisitor.mEvent->message == NS_PAGE_UNLOAD &&
              NS_IS_TRUSTED_EVENT(aVisitor.mEvent)) {
     // Execute bindingdetached handlers before we tear ourselves
     // down.
new file mode 100644
--- /dev/null
+++ b/editor/libeditor/base/crashtests/430624-1.html
@@ -0,0 +1,14 @@
+function crash() {
+  window.frames[0].onload = null;
+  window.frames[0].location = 'data:text/html;charset=utf-8,2nd%20page';
+<body onload="crash()">
+  <!-- iframe contents: <html><body onload="document.body.setAttribute('spellcheck', true);"></body></html> -->
+  <iframe src="data:text/html;charset=utf-8;base64,PGh0bWw%2BPGJvZHkgb25sb2FkPSJkb2N1bWVudC5ib2R5LnNldEF0dHJpYnV0ZSgnc3BlbGxjaGVjaycsIHRydWUpOyI%2BPC9ib2R5PjwvaHRtbD4%3D"></iframe>
\ No newline at end of file
--- a/editor/libeditor/base/crashtests/crashtests.list
+++ b/editor/libeditor/base/crashtests/crashtests.list
@@ -1,3 +1,4 @@
 load 382527-1.html
 load 402172-1.html
 load 407256-1.html
+load 430624-1.html
deleted file mode 100644
--- a/extensions/canvas3d/
+++ /dev/null
@@ -1,56 +0,0 @@
-# ***** BEGIN LICENSE BLOCK *****
-# Version: MPL 1.1/GPL 2.0/LGPL 2.1
-# The contents of this file are subject to the Mozilla Public License Version
-# 1.1 (the "License"); you may not use this file except in compliance with
-# the License. You may obtain a copy of the License at
-# Software distributed under the License is distributed on an "AS IS" basis,
-# WITHOUT WARRANTY OF ANY KIND, either express or implied. See the License
-# for the specific language governing rights and limitations under the
-# License.
-# The Original Code is canvas code.
-# The Initial Developer of the Original Code is
-#   Mozilla
-# Portions created by the Initial Developer are Copyright (C) 2006
-# the Initial Developer. All Rights Reserved.
-# Contributor(s):
-#   Vladimir Vukicevic <>
-# Alternatively, the contents of this file may be used under the terms of
-# either of the GNU General Public License Version 2 or later (the "GPL"),
-# or the GNU Lesser General Public License Version 2.1 or later (the "LGPL"),
-# in which case the provisions of the GPL or the LGPL are applicable instead
-# of those above. If you wish to allow use of your version of this file only
-# under the terms of either the GPL or the LGPL, and not to allow others to
-# use your version of this file under the terms of the MPL, indicate your
-# decision by deleting the provisions above and replace them with the notice
-# and other provisions required by the GPL or the LGPL. If you do not delete
-# the provisions above, a recipient may use your version of this file under
-# the terms of any one of the MPL, the GPL or the LGPL.
-# ***** END LICENSE BLOCK *****
-DEPTH            = ../..
-topsrcdir        = @top_srcdir@
-srcdir           = @srcdir@
-VPATH            = @srcdir@
-include $(DEPTH)/config/
-MODULE		= canvas3d
-DIRS            = public src
-XPI_NAME	= canvas3d
-XPI_PKGNAME	= canvas3d
-DIST_FILES = install.rdf
-include $(topsrcdir)/config/
deleted file mode 100644
--- a/extensions/canvas3d/doc/glweb20spec.html
+++ /dev/null
@@ -1,640 +0,0 @@
-    <style type="text/css">
-.glfuncs {
-      border: 1px solid gray;
-      width: 100%;
-      font-family: Lucida Sans Console, Lucida Console, Bitstream Vera Mono, Courier New, Courier, monospace;
-      font-size: x-small;
-.gldifferent {
-      background: #ffeeee;
-tr > th {
-      font-family: sans;
-      font-size: small;
-      background: #dddddd;
-.glgroup {
-      padding-top: 5px;
-      font-family: sans;
-      font-size: small;
-      background: #ddddff;
-    </style>
-<h3>API Mapping</h3>
-<table class="glfuncs">
-<tr style="font-family: sans">
-<th width="50%">GL ES 2.0</th>
-<tr><td class="glgroup" colspan="2"><b><i>Core GL ES 2.0</i></b></td></tr>
-<td>ActiveTexture (GLenum texture)</td>
-<td>AttachShader (GLuint program, GLuint shader)</td>
-<td>BindAttribLocation (GLuint program, GLuint index, const char *name)</td>
-<td>BindBuffer (GLenum target, GLuint buffer)</td>
-<td>BindTexture (GLenum target, GLuint texture)</td>
-<td>BlendColor (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha)</td>
-<td>BlendEquation (GLenum mode)</td>
-<td>BlendEquationSeparate (GLenum modeRGB, GLenum modeAlpha)</td>
-<td>BlendFunc (GLenum sfactor, GLenum dfactor)</td>
-<td>BlendFuncSeparate (GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha)</td>
-<tr class="gldifferent">
-<td>BufferData (GLenum target, GLsizeiptr size, const void *data, GLenum usage)</td>
-<td>bufferData (uint target, Array data, uint elementType, uint usage)</td>
-<tr class="gldifferent">
-<td>BufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, const void *data)</td>
-<td>bufferSubData (uint target, uint offset, Array data, uint elementType)</td>
-<td>Clear (GLbitfield mask)</td>
-<td>ClearColor (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha)</td>
-<tr class="gldifferent">
-<td>ClearDepthf (GLclampf depth)</td>
-<td>clearDepth (float depth);</td>
-<td>ClearStencil (GLint s)</td>
-<td>ColorMask (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha)</td>
-<tr class="gldifferent">
-<td>CompressedTexImage2D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data)</td>
-<td><i>see texImage2DHTML</i></td>
-<tr class="gldifferent">
-<td>CompressedTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data)</td>
-<td><i>see texSubImage2DHTML</i></td>
-<tr class="gldifferent">
-<td>CopyTexImage2D (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border)</td>
-<tr class="gldifferent">
-<td>CopyTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height)</td>
-<td>uint glCreateProgram (void)</td>
-<td>uint glCreateShader (GLenum type)</td>
-<td>CullFace (GLenum mode)</td>
-<tr class="gldifferent">
-<td>DeleteBuffers (GLsizei n, const GLuint *buffers)</td>
-<td>deleteBuffers (Array buffers)</td>
-<tr class="gldifferent">
-<td>DeleteTextures (GLsizei n, const GLuint *textures)</td>
-<td>deleteTextures (Array textures)</td>
-<td>DeleteProgram (GLuint program)</td>
-<td>DeleteShader (GLuint shader)</td>
-<td>DetachShader (GLuint program, GLuint shader)</td>
-<td>DepthFunc (GLenum func)</td>
-<td>DepthMask (GLboolean flag)</td>
-<td>DepthRangef (GLclampf zNear, GLclampf zFar)</td>
-<td>Disable (GLenum cap)</td>
-<td>DisableVertexAttribArray (GLuint index)</td>
-<td>DrawArrays (GLenum mode, GLint first, GLsizei count)</td>
-<tr class="gldifferent">
-<td>DrawElements (GLenum mode, GLsizei count, GLenum type, const void *indices)</td>
-<td>Enable (GLenum cap)</td>
-<td>EnableVertexAttribArray (GLuint index)</td>
-<tr class="gldifferent">
-<td>Finish (void)</td>
-<tr class="gldifferent">
-<td>Flush (void)</td>
-<td>FrontFace (GLenum mode)</td>
-<tr class="gldifferent">
-<td>GetActiveAttrib (GLuint program, GLuint index, GLsizei bufsize, GLsizei *length, GLint *size, GLenum *type, char *name)</td><td>Object getActiveAttrib (uint program, uint index)<br>
-obj = { type: ..., size: ..., name: ... }</td>
-<tr class="gldifferent">
-<td>GetActiveUniform (GLuint program, GLuint index, GLsizei bufsize, GLsizei *length, GLint *size, GLenum *type, char *name)</td>
-<td>Object getActiveUniform (uint program, uint index)<br>
-obj = { type: ..., size: ..., name: ... }</td>
-<tr class="gldifferent">
-<td>GetAttachedShaders (GLuint program, GLsizei maxcount, GLsizei *count, GLuint *shaders)</td>
-<td>Array getAttachedShaders (uint program)</td>
-<tr class="gldifferent">
-<td>int glGetAttribLocation (GLuint program, const char *name)</td>
-<td>int getAttribLocation (uint program, string name)</td>
-<tr class="gldifferent">
-<td>GetBooleanv (GLenum pname, GLboolean *params)</td>
-<td><i>see getParameter</i></td>
-<tr class="gldifferent">
-<td>GetBufferParameteriv (GLenum target, GLenum pname, GLint *params)</td>
-<td><i>see getBufferParameter</i></td>
-<tr class="gldifferent">
-<td>GenBuffers (GLsizei n, GLuint *buffers)</td>
-<td>Array genBuffers (uint n)</td>
-<tr class="gldifferent">
-<td>GenTextures (GLsizei n, GLuint *textures)</td>
-<td>Array genTextures (uint n)</td>
-<td>enum glGetError (void)</td>
-<tr class="gldifferent">
-<td>GetFloatv (GLenum pname, GLfloat *params)</td>
-<td><i>see getParameter</i></td>
-<tr class="gldifferent">
-<td>GetIntegerv (GLenum pname, GLint *params)</td>
-<td><i>see getParameter</i></td>
-<tr class="gldifferent">
-<td>GetPointerv (GLenum pname, void **params)</td>
-<td><i>see getParameter</i></td>
-<tr class="gldifferent">
-<td>GetProgramiv (GLuint program, GLenum pname, GLint *params)</td>
-<td><i>see getProgramParameter</i></td>
-<tr class="gldifferent">
-<td>GetProgramInfoLog (GLuint program, GLsizei bufsize, GLsizei *length, char *infolog)</td>
-<td>string getProgramInfoLog (uint program)</td>
-<tr class="gldifferent">
-<td>const GLubyte * glGetString (GLenum name)</td>
-<td><i>see getParameter</i></td>
-<tr class="gldifferent">
-<td>GetTexParameteriv (GLenum target, GLenum pname, GLint *params)</td>
-<td><i>see getTexParameter</i></td>
-<tr class="gldifferent">
-<td>GetTexParameterfv (GLenum target, GLenum pname, GLfloat *params)</td>
-<td><i>see getTexParameter</i></td>
-<tr class="gldifferent">
-<td>GetUniformfv (GLuint program, GLint location, GLfloat *params)</td>
-<tr class="gldifferent">
-<td>GetUniformiv (GLuint program, GLint location, GLint *params)</td>
-<tr class="gldifferent">
-<td>int glGetUniformLocation (GLuint program, const char *name)</td>
-<td>int getUniformLocation (uint program, string name)</td>
-<tr class="gldifferent">
-<td>GetVertexAttribfv (GLuint index, GLenum pname, GLfloat *params)</td>
-<td><i>see getVertexAttrib</i></td>
-<tr class="gldifferent">
-<td>GetVertexAttribiv (GLuint index, GLenum pname, GLint *params)</td>
-<td><i>see getVertexAttrib</i></td>
-<tr class="gldifferent">
-<td>GetVertexAttribPointerv (GLuint index, GLenum pname, void **pointer)</td>
-<td><i>see getVertexAttrib</i></td>
-<td>Hint (GLenum target, GLenum mode)</td>
-<td>boolean glIsBuffer (GLuint buffer)</td>
-<td>boolean glIsEnabled (GLenum cap)</td>
-<td>boolean glIsProgram (GLuint program)</td>
-<td>boolean glIsShader (GLuint shader)</td>
-<td>boolean glIsTexture (GLuint texture)</td>
-<td>LineWidth (GLfloat width)</td>
-<td>LinkProgram (GLuint program)</td>
-<tr class="gldifferent">
-<td>PixelStorei (GLenum pname, GLint param)</td>
-<td>PointSize (GLfloat size)</td>
-<td>PolygonOffset (GLfloat factor, GLfloat units)</td>
-<tr class="gldifferent">
-<td>ReadPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, void *pixels)</td>
-<td>SampleCoverage (GLclampf value, GLboolean invert)</td>
-<td>Scissor (GLint x, GLint y, GLsizei width, GLsizei height)</td>
-<td>StencilFunc (GLenum func, GLint ref, GLuint mask)</td>
-<td>StencilFuncSeparate (GLenum face, GLenum func, GLint ref, GLuint mask)</td>
-<td>StencilMask (GLuint mask)</td>
-<td>StencilMaskSeparate (GLenum face, GLuint mask)</td>
-<td>StencilOp (GLenum fail, GLenum zfail, GLenum zpass)</td>
-<td>StencilOpSeparate (GLenum face, GLenum fail, GLenum zfail, GLenum zpass)</td>
-<tr class="gldifferent">
-<td>TexImage2D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels)</td>
-<td><i>see texImage2DHTML</i></td>
-<tr class="gldifferent">
-<td>TexParameteri (GLenum target, GLenum pname, GLint param)</td>
-<td><i>see texParameter</i></td>
-<tr class="gldifferent">
-<td>TexParameterf (GLenum target, GLenum pname, GLfloat param)</td>
-<td><i>see texParameter</i></td>
-<tr class="gldifferent">
-<td>TexParameteriv (GLenum target, GLenum pname, const GLint *params)</td>
-<td><i>see texParameter</i></td>
-<tr class="gldifferent">
-<td>TexParameterfv (GLenum target, GLenum pname, const GLfloat *params)</td>
-<td><i>see texParameter</i></td>
-<tr class="gldifferent">
-<td>TexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels)</td>
-<td><i>see texSubImage2DHTML</i></td>
-<tr class="gldifferent">
-<td>Uniform1i (GLint location, GLint x)<br>
-Uniform2i (GLint location, GLint x, GLint y)<br>
-Uniform3i (GLint location, GLint x, GLint y, GLint z)<br>
-Uniform4i (GLint location, GLint x, GLint y, GLint z, GLint w)<br>
-Uniform1iv (GLint location, GLsizei count, const GLint *v)<br>
-Uniform2iv (GLint location, GLsizei count, const GLint *v)<br>
-Uniform3iv (GLint location, GLsizei count, const GLint *v)<br>
-Uniform4iv (GLint location, GLsizei count, const GLint *v)</td>
-<td><i>see uniformi</i></td>
-<tr class="gldifferent">
-<td>Uniform1f (GLint location, GLfloat x)<br>
-Uniform2f (GLint location, GLfloat x, GLfloat y)<br>
-Uniform3f (GLint location, GLfloat x, GLfloat y, GLfloat z)<br>
-Uniform4f (GLint location, GLfloat x, GLfloat y, GLfloat z, GLfloat w)<br>
-Uniform1fv (GLint location, GLsizei count, const GLfloat *v)<br>
-Uniform2fv (GLint location, GLsizei count, const GLfloat *v)<br>
-Uniform3fv (GLint location, GLsizei count, const GLfloat *v)<br>
-Uniform4fv (GLint location, GLsizei count, const GLfloat *v)</td>
-<td><i>see uniformf</i></td>
-<tr class="gldifferent">
-<td>UniformMatrix2fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value)<br>
-UniformMatrix3fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value)<br>
-UniformMatrix4fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value)</td>
-<td><i>see uniformMatrix</i></td>
-<td>UseProgram (GLuint program)</td>
-<td>ValidateProgram (GLuint program)</td>
-<tr class="gldifferent">
-<td>VertexAttrib1f (GLuint indx, GLfloat x)<br>
-VertexAttrib2f (GLuint indx, GLfloat x, GLfloat y)<br>
-VertexAttrib3f (GLuint indx, GLfloat x, GLfloat y, GLfloat z)<br>
-VertexAttrib4f (GLuint indx, GLfloat x, GLfloat y, GLfloat z, GLfloat w)<br>
-VertexAttrib1fv (GLuint indx, const GLfloat *values)<br>
-VertexAttrib2fv (GLuint indx, const GLfloat *values)<br>
-VertexAttrib3fv (GLuint indx, const GLfloat *values)<br>
-VertexAttrib4fv (GLuint indx, const GLfloat *values)</td>
-<tr class="gldifferent">
-<td>VertexAttribPointer (GLuint indx, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *ptr)</td>
-<td>vertexAttribPointer (uint index, Object bufferObject)<br>
-vertexAttribPointer (uint index, uint size, uint elementType, Array data)
-<td>Viewport (GLint x, GLint y, GLsizei width, GLsizei height)</td>
-<tr><td class="glgroup" colspan="2"><b><i>OES_framebuffer_object</i></b></td></tr>
-<tr><td class="gldifferent"><i>TODO</i></td></tr>
-<tr><td class="glgroup" colspan="2"><b><i>OES_mapbuffer</i></b></td></tr>
-<tr><td class="gldifferent"><i>NOT SUPPORTED</i></td></tr>
-<tr><td class="glgroup" colspan="2"><b><i>OES_texture_3D</i></b></td></tr>
-<tr><td class="gldifferent"><i>TODO</i></td></tr>
-<tr><td class="glgroup" colspan="2"><b><i>OES_shader_source</i></b></td></tr>
-<tr><td class="gldifferent"><i>TODO</i></td></tr>
-<td>CompileShader (GLuint shader)</td>
-<tr class="gldifferent">
-<td>GetShaderiv (GLuint shader, GLenum pname, GLint *params)</td>
-<td><i>see getShaderParameter</i></td>
-<tr class="gldifferent">
-<td>GetShaderInfoLog (GLuint shader, GLsizei bufsize, GLsizei *length, char *infolog)</td>
-<td>string getShaderInfoLog (uint shader)</td>
-<tr class="gldifferent">
-<td>GetShaderSource (GLuint shader, GLsizei bufsize, GLsizei *length, char *source)</td>
-<tr class="gldifferent">
-<tr class="gldifferent">
-<td>ShaderSource(GLuint shader, GLsizei count, const char **string, const GLint *length)</td>
-<td>shaderSource(uint shader, string source)</td>
-<tr><td class="glgroup" colspan="2"><b><i>OES_shader_binary</i></b></td></tr>
-<tr><td class="gldifferent"><i>NOT SUPPORTED</i></td></tr>
-<h3>API Additions</h3>
-<td>texImage2DHTML (uint target, DOMImageElement image)<br>
-texImage2DHTML (uint target, int level, DOMImageElement image)</td>
-<td>texSubImage2DHTML (uint target, DOMImageElement image, int xoff, int yoff, int width, int height)<br>
-texSubImage2DHTML (uint target, int level, DOMImageElement image, int xoff, int yoff, int width, int height)</td>
-<td>getParameter (uint pname)</td>
-<td>getBufferParameter (uint target, uint pname)</td>
deleted file mode 100644
--- a/extensions/canvas3d/install.rdf
+++ /dev/null
@@ -1,31 +0,0 @@
-<?xml version="1.0"?>
-<RDF xmlns=""
-     xmlns:em="">
-  <Description about="urn:mozilla:install-manifest">
-    <em:id></em:id>
-    <em:version>0.1.18</em:version>
-    <em:type>2</em:type>
-    <em:targetApplication>
-      <!-- Firefox -->
-      <Description>
-        <em:id>{ec8030f7-c20a-464f-9b0e-13a3a9e97384}</em:id>
-	<!-- this version needs to be set to the exact version this
-	     extension was built for, because of the way we're tied
-	     to internal interfaces.
-	  -->
-        <em:minVersion>3.0a8pre</em:minVersion>
-        <em:maxVersion>3.0</em:maxVersion>
-      </Description>
-    </em:targetApplication>
-    <!-- front-end metadata -->
-    <em:creator>Vladimir Vukicevic/</em:creator>
-    <em:name>Canvas 3D (Gecko 1.9)</em:name>
-    <em:description>Canvas 3D context(s) for Gecko 1.9</em:description>
-    <em:homepageURL></em:homepageURL>
-    <em:optionsURL>chrome://canvas3d/content/options.xul</em:optionsURL>
-  </Description>
deleted file mode 100644
--- a/extensions/canvas3d/
+++ /dev/null
@@ -1,3 +0,0 @@
-% content canvas3d %content/canvas3d/
-  content/canvas3d/options.xul                   (resources/content/options.xul)
deleted file mode 100644
--- a/extensions/canvas3d/public/
+++ /dev/null
@@ -1,58 +0,0 @@
-# ***** BEGIN LICENSE BLOCK *****
-# Version: MPL 1.1/GPL 2.0/LGPL 2.1
-# The contents of this file are subject to the Mozilla Public License Version
-# 1.1 (the "License"); you may not use this file except in compliance with
-# the License. You may obtain a copy of the License at
-# Software distributed under the License is distributed on an "AS IS" basis,
-# WITHOUT WARRANTY OF ANY KIND, either express or implied. See the License
-# for the specific language governing rights and limitations under the
-# License.
-# The Original Code is canvas code.
-# The Initial Developer of the Original Code is
-#   Mozilla
-# Portions created by the Initial Developer are Copyright (C) 2006
-# the Initial Developer. All Rights Reserved.
-# Contributor(s):
-#   Vladimir Vukicevic <>
-# Alternatively, the contents of this file may be used under the terms of
-# either of the GNU General Public License Version 2 or later (the "GPL"),
-# or the GNU Lesser General Public License Version 2.1 or later (the "LGPL"),
-# in which case the provisions of the GPL or the LGPL are applicable instead
-# of those above. If you wish to allow use of your version of this file only
-# under the terms of either the GPL or the LGPL, and not to allow others to
-# use your version of this file under the terms of the MPL, indicate your
-# decision by deleting the provisions above and replace them with the notice
-# and other provisions required by the GPL or the LGPL. If you do not delete
-# the provisions above, a recipient may use your version of this file under
-# the terms of any one of the MPL, the GPL or the LGPL.
-# ***** END LICENSE BLOCK *****
-DEPTH            = ../../..
-topsrcdir        = @top_srcdir@
-srcdir           = @srcdir@
-VPATH            = @srcdir@
-include $(DEPTH)/config/
-MODULE		= canvas3d
-XPI_NAME	= canvas3d
-	nsICanvasRenderingContextGL.idl \
-	nsICanvasRenderingContextGLBuffer.idl \
-	nsICanvasRenderingContextGLWeb20.idl \
-	nsICanvasRenderingContextGLES11.idl \
-	nsICanvasGLPrivate.idl \
-	$(NULL)
-include $(topsrcdir)/config/
deleted file mode 100644
--- a/extensions/canvas3d/public/nsICanvasGLPrivate.idl
+++ /dev/null
@@ -1,53 +0,0 @@
-/* -*- Mode: IDL; tab-width: 2; indent-tabs-mode: nil; c-basic-offset: 2 -*- */
-/* ***** BEGIN LICENSE BLOCK *****
- * Version: MPL 1.1/GPL 2.0/LGPL 2.1
- *
- * The contents of this file are subject to the Mozilla Public License Version
- * 1.1 (the "License"); you may not use this file except in compliance with
- * the License. You may obtain a copy of the License at
- *
- *
- * Software distributed under the License is distributed on an "AS IS" basis,
- * WITHOUT WARRANTY OF ANY KIND, either express or implied. See the License
- * for the specific language governing rights and limitations under the
- * License.
- *
- * The Original Code is canvas 3D.
- *
- * The Initial Developer of the Original Code is
- *   Mozilla Corporation.
- * Portions created by the Initial Developer are Copyright (C) 2007
- * the Initial Developer. All Rights Reserved.
- *
- * Contributor(s):
- *   Vladimir Vukicevic <>
- *
- * Alternatively, the contents of this file may be used under the terms of
- * either of the GNU General Public License Version 2 or later (the "GPL"),
- * or the GNU Lesser General Public License Version 2.1 or later (the "LGPL"),
- * in which case the provisions of the GPL or the LGPL are applicable instead
- * of those above. If you wish to allow use of your version of this file only
- * under the terms of either the GPL or the LGPL, and not to allow others to
- * use your version of this file under the terms of the MPL, indicate your
- * decision by deleting the provisions above and replace them with the notice
- * and other provisions required by the GPL or the LGPL. If you do not delete
- * the provisions above, a recipient may use your version of this file under
- * the terms of any one of the MPL, the GPL or the LGPL.
- *
- * ***** END LICENSE BLOCK ***** */
-#include "nsISupports.idl"
-/* These are private interface that's used to identify
- * specific concrete classes so we know what we can cast.
- */
-[scriptable, uuid(eba2aa03-ae19-46e2-bad7-6b966037e22c)]
-interface nsICanvasGLBuffer : nsISupports
-[scriptable, uuid(27310aab-1988-43e8-882e-6293c8c9df60)]
-interface nsICanvasGLTexture : nsISupports
deleted file mode 100644
--- a/extensions/canvas3d/public/nsICanvasRenderingContextGL.idl
+++ /dev/null
@@ -1,602 +0,0 @@
-/* -*- Mode: IDL; tab-width: 2; indent-tabs-mode: nil; c-basic-offset: 2 -*- */
-/* ***** BEGIN LICENSE BLOCK *****
- * Version: MPL 1.1/GPL 2.0/LGPL 2.1
- *
- * The contents of this file are subject to the Mozilla Public License Version
- * 1.1 (the "License"); you may not use this file except in compliance with
- * the License. You may obtain a copy of the License at
- *
- *
- * Software distributed under the License is distributed on an "AS IS" basis,
- * WITHOUT WARRANTY OF ANY KIND, either express or implied. See the License
- * for the specific language governing rights and limitations under the
- * License.
- *
- * The Original Code is canvas 3D.
- *
- * The Initial Developer of the Original Code is
- *   Mozilla Corporation.
- * Portions created by the Initial Developer are Copyright (C) 2007
- * the Initial Developer. All Rights Reserved.
- *
- * Contributor(s):
- *   Vladimir Vukicevic <>
- *
- * Alternatively, the contents of this file may be used under the terms of
- * either of the GNU General Public License Version 2 or later (the "GPL"),
- * or the GNU Lesser General Public License Version 2.1 or later (the "LGPL"),
- * in which case the provisions of the GPL or the LGPL are applicable instead
- * of those above. If you wish to allow use of your version of this file only
- * under the terms of either the GPL or the LGPL, and not to allow others to
- * use your version of this file under the terms of the MPL, indicate your
- * decision by deleting the provisions above and replace them with the notice
- * and other provisions required by the GPL or the LGPL. If you do not delete
- * the provisions above, a recipient may use your version of this file under
- * the terms of any one of the MPL, the GPL or the LGPL.
- *
- * ***** END LICENSE BLOCK ***** */
-#include "nsISupports.idl"
-interface nsIDOMHTMLCanvasElement;
-[scriptable, uuid(0f3d8dae-7d43-490b-93e9-5ff908ac6ff5)]
-interface nsICanvasRenderingContextGL : nsISupports
-  readonly attribute nsIDOMHTMLCanvasElement canvas;
-  /**
-   ** GL constants
-   **/
-  /* types */
-  const PRUint32 BYTE                           = 0x1400;
-  const PRUint32 UNSIGNED_BYTE                  = 0x1401;
-  const PRUint32 SHORT                          = 0x1402;
-  const PRUint32 UNSIGNED_SHORT                 = 0x1403;
-  const PRUint32 INT                            = 0x1404;
-  const PRUint32 UNSIGNED_INT                   = 0x1405;
-  const PRUint32 FLOAT                          = 0x1406;
-  const PRUint32 TWO_BYTES                      = 0x1407;
-  const PRUint32 THREE_BYTES                    = 0x1408;
-  const PRUint32 FOUR_BYTES                     = 0x1409;
-  const PRUint32 DOUBLE                         = 0x140A;
-  /* ClearBufferMask */
-  const PRUint32 DEPTH_BUFFER_BIT               = 0x00000100;
-  const PRUint32 STENCIL_BUFFER_BIT             = 0x00000400;
-  const PRUint32 COLOR_BUFFER_BIT               = 0x00004000;
-  /* BeginMode */
-  const PRUint32 POINTS                         = 0x0000;
-  const PRUint32 LINES                          = 0x0001;
-  const PRUint32 LINE_LOOP                      = 0x0002;
-  const PRUint32 LINE_STRIP                     = 0x0003;
-  const PRUint32 TRIANGLES                      = 0x0004;
-  const PRUint32 TRIANGLE_STRIP                 = 0x0005;
-  const PRUint32 TRIANGLE_FAN                   = 0x0006;
-  /* AlphaFunction */
-  const PRUint32 NEVER                          = 0x0200;
-  const PRUint32 LESS                           = 0x0201;
-  const PRUint32 EQUAL                          = 0x0202;
-  const PRUint32 LEQUAL                         = 0x0203;
-  const PRUint32 GREATER                        = 0x0204;
-  const PRUint32 NOTEQUAL                       = 0x0205;
-  const PRUint32 GEQUAL                         = 0x0206;
-  const PRUint32 ALWAYS                         = 0x0207;
-  /* BlendingFactorDest */
-  const PRUint32 ZERO                           = 0;
-  const PRUint32 ONE                            = 1;
-  const PRUint32 SRC_COLOR                      = 0x0300;
-  const PRUint32 ONE_MINUS_SRC_COLOR            = 0x0301;
-  const PRUint32 SRC_ALPHA                      = 0x0302;
-  const PRUint32 ONE_MINUS_SRC_ALPHA            = 0x0303;
-  const PRUint32 DST_ALPHA                      = 0x0304;
-  const PRUint32 ONE_MINUS_DST_ALPHA            = 0x0305;
-  /* BlendingFactorSrc */
-  /*    ZERO */
-  /*    ONE */
-  const PRUint32 DST_COLOR                      = 0x0306;
-  const PRUint32 ONE_MINUS_DST_COLOR            = 0x0307;
-  const PRUint32 SRC_ALPHA_SATURATE             = 0x0308;
-  /*    SRC_ALPHA */
-  /*    DST_ALPHA */
-  /* BlendEquationSeperate */
-  const PRUint32 FUNC_ADD = 0x8006;
-  const PRUint32 BLEND_EQUATION = 0x8009;
-  const PRUint32 BLEND_EQUATION_RGB = 0x8009;
-  const PRUint32 BLEND_EQUATION_ALPHA = 0x883D;
-  /* BlendSubtract */
-  const PRUint32 FUNC_SUBTRACT = 0x800A;
-  const PRUint32 FUNC_REVERSE_SUBTRACT = 0x800B;
-  /* Separate Blend Functions i.e. GL_OES_blend_func_seperate */
-  const PRUint32 BLEND_DST_RGB = 0x80C8;
-  const PRUint32 BLEND_SRC_RGB = 0x80C9;
-  const PRUint32 BLEND_DST_ALPHA = 0x80CA;
-  const PRUint32 BLEND_SRC_ALPHA = 0x80CB;
-  const PRUint32 CONSTANT_COLOR = 0x8001;
-  const PRUint32 ONE_MINUS_CONSTANT_COLOR = 0x8002;
-  const PRUint32 CONSTANT_ALPHA = 0x8003;
-  const PRUint32 ONE_MINUS_CONSTANT_ALPHA = 0x8004;
-  const PRUint32 BLEND_COLOR = 0x8005;
-  /* Buffer Objects */
-  const PRUint32 BUFFER_SIZE = 0x8764;
-  const PRUint32 BUFFER_USAGE = 0x8765;
-  const PRUint32 BUFFER_ACCESS = 0x88BB;
-  const PRUint32 CURRENT_VERTEX_ATTRIB = 0x8626;
-  /* ClipPlaneName */
-  const PRUint32 CLIP_PLANE0                    = 0x3000;
-  const PRUint32 CLIP_PLANE1                    = 0x3001;
-  const PRUint32 CLIP_PLANE2                    = 0x3002;
-  const PRUint32 CLIP_PLANE3                    = 0x3003;
-  const PRUint32 CLIP_PLANE4                    = 0x3004;
-  const PRUint32 CLIP_PLANE5                    = 0x3005;
-  /* ColorMaterialFace */
-  /*    FRONT_AND_BACK */
-  /* ColorMaterialParameter */
-  /* CullFaceMode */
-  const PRUint32 FRONT                          = 0x0404;
-  const PRUint32 BACK                           = 0x0405;
-  const PRUint32 FRONT_AND_BACK                 = 0x0408;
-  /* DepthFunction */
-  /*    NEVER */
-  /*    LESS */
-  /*    EQUAL */
-  /*    LEQUAL */
-  /*    GREATER */
-  /*    NOTEQUAL */
-  /*    GEQUAL */
-  /*    ALWAYS */
-  /* EnableCap */
-  const PRUint32 FOG                            = 0x0B60;
-  const PRUint32 LIGHTING                       = 0x0B50;
-  const PRUint32 TEXTURE_2D                     = 0x0DE1;
-  const PRUint32 CULL_FACE                      = 0x0B44;
-  const PRUint32 ALPHA_TEST                     = 0x0BC0;
-  const PRUint32 BLEND                          = 0x0BE2;
-  const PRUint32 COLOR_LOGIC_OP                 = 0x0BF2;
-  const PRUint32 DITHER                         = 0x0BD0;
-  const PRUint32 STENCIL_TEST                   = 0x0B90;
-  const PRUint32 DEPTH_TEST                     = 0x0B71;
-  /*             LIGHT0 */
-  /*             LIGHT1 */
-  /*             LIGHT2 */
-  /*             LIGHT3 */
-  /*             LIGHT4 */
-  /*             LIGHT5 */
-  /*             LIGHT6 */
-  /*             LIGHT7 */
-  const PRUint32 POINT_SMOOTH                   = 0x0B10;
-  const PRUint32 LINE_SMOOTH                    = 0x0B20;
-  const PRUint32 SCISSOR_TEST                   = 0x0C11;
-  const PRUint32 COLOR_MATERIAL                 = 0x0B57;
-  const PRUint32 NORMALIZE                      = 0x0BA1;
-  const PRUint32 RESCALE_NORMAL                 = 0x803A;
-  const PRUint32 POLYGON_OFFSET_FILL            = 0x8037;
-  const PRUint32 VERTEX_ARRAY                   = 0x8074;
-  const PRUint32 NORMAL_ARRAY                   = 0x8075;
-  const PRUint32 COLOR_ARRAY                    = 0x8076;
-  const PRUint32 TEXTURE_COORD_ARRAY            = 0x8078;
-  const PRUint32 MULTISAMPLE                    = 0x809D;
-  const PRUint32 SAMPLE_ALPHA_TO_COVERAGE       = 0x809E;
-  const PRUint32 SAMPLE_ALPHA_TO_ONE            = 0x809F;
-  const PRUint32 SAMPLE_COVERAGE                = 0x80A0;
-  /* ErrorCode */
-  const PRUint32 NO_ERROR                       = 0;
-  const PRUint32 INVALID_ENUM                   = 0x0500;
-  const PRUint32 INVALID_VALUE                  = 0x0501;
-  const PRUint32 INVALID_OPERATION              = 0x0502;
-  const PRUint32 STACK_OVERFLOW                 = 0x0503;
-  const PRUint32 STACK_UNDERFLOW                = 0x0504;
-  const PRUint32 OUT_OF_MEMORY                  = 0x0505;
-  /* FogMode */
-  /*             LINEAR */
-  const PRUint32 EXP                            = 0x0800;
-  const PRUint32 EXP2                           = 0x0801;
-  /* FogParameter */
-  const PRUint32 FOG_DENSITY                    = 0x0B62;
-  const PRUint32 FOG_START                      = 0x0B63;
-  const PRUint32 FOG_END                        = 0x0B64;
-  const PRUint32 FOG_MODE                       = 0x0B65;
-  const PRUint32 FOG_COLOR                      = 0x0B66;
-  /* FrontFaceDirection */
-  const PRUint32 CW                             = 0x0900;
-  const PRUint32 CCW                            = 0x0901;
-  /* GetPName */
-  const PRUint32 CURRENT_COLOR                  = 0x0B00;
-  const PRUint32 CURRENT_NORMAL                 = 0x0B02;
-  const PRUint32 CURRENT_TEXTURE_COORDS         = 0x0B03;
-  const PRUint32 POINT_SIZE                     = 0x0B11;
-  const PRUint32 POINT_SIZE_MIN                 = 0x8126;
-  const PRUint32 POINT_SIZE_MAX                 = 0x8127;
-  const PRUint32 POINT_FADE_THRESHOLD_SIZE      = 0x8128;
-  const PRUint32 POINT_DISTANCE_ATTENUATION     = 0x8129;
-  const PRUint32 SMOOTH_POINT_SIZE_RANGE        = 0x0B12;
-  const PRUint32 LINE_WIDTH                     = 0x0B21;
-  const PRUint32 SMOOTH_LINE_WIDTH_RANGE        = 0x0B22;
-  const PRUint32 ALIASED_POINT_SIZE_RANGE       = 0x846D;
-  const PRUint32 ALIASED_LINE_WIDTH_RANGE       = 0x846E;
-  const PRUint32 CULL_FACE_MODE                 = 0x0B45;
-  const PRUint32 FRONT_FACE                     = 0x0B46;
-  const PRUint32 SHADE_MODEL                    = 0x0B54;
-  const PRUint32 DEPTH_RANGE                    = 0x0B70;
-  const PRUint32 DEPTH_WRITEMASK                = 0x0B72;
-  const PRUint32 DEPTH_CLEAR_VALUE              = 0x0B73;
-  const PRUint32 DEPTH_FUNC                     = 0x0B74;
-  const PRUint32 STENCIL_CLEAR_VALUE            = 0x0B91;
-  const PRUint32 STENCIL_FUNC                   = 0x0B92;
-  const PRUint32 STENCIL_VALUE_MASK             = 0x0B93;
-  const PRUint32 STENCIL_FAIL                   = 0x0B94;
-  const PRUint32 STENCIL_PASS_DEPTH_FAIL        = 0x0B95;
-  const PRUint32 STENCIL_PASS_DEPTH_PASS        = 0x0B96;
-  const PRUint32 STENCIL_REF                    = 0x0B97;
-  const PRUint32 STENCIL_WRITEMASK              = 0x0B98;
-  const PRUint32 MATRIX_MODE                    = 0x0BA0;
-  // VIEWPORT -> VIEWPORT_VALUE, because viewport() conflicts
-  const PRUint32 VIEWPORT_VALUE                 = 0x0BA2;
-  const PRUint32 MODELVIEW_STACK_DEPTH          = 0x0BA3;
-  const PRUint32 PROJECTION_STACK_DEPTH         = 0x0BA4;
-  const PRUint32 TEXTURE_STACK_DEPTH            = 0x0BA5;
-  const PRUint32 MODELVIEW_MATRIX               = 0x0BA6;
-  const PRUint32 PROJECTION_MATRIX              = 0x0BA7;
-  const PRUint32 TEXTURE_MATRIX                 = 0x0BA8;
-  const PRUint32 ALPHA_TEST_FUNC                = 0x0BC1;
-  const PRUint32 ALPHA_TEST_REF                 = 0x0BC2;
-  const PRUint32 BLEND_DST                      = 0x0BE0;
-  const PRUint32 BLEND_SRC                      = 0x0BE1;
-  const PRUint32 LOGIC_OP_MODE                  = 0x0BF0;
-  const PRUint32 SCISSOR_BOX                    = 0x0C10;
-  /*             SCISSOR_TEST */
-  const PRUint32 COLOR_CLEAR_VALUE              = 0x0C22;
-  const PRUint32 COLOR_WRITEMASK                = 0x0C23;
-  const PRUint32 UNPACK_ALIGNMENT               = 0x0CF5;
-  const PRUint32 PACK_ALIGNMENT                 = 0x0D05;
-  const PRUint32 MAX_LIGHTS                     = 0x0D31;
-  const PRUint32 MAX_CLIP_PLANES                = 0x0D32;
-  const PRUint32 MAX_TEXTURE_SIZE               = 0x0D33;
-  const PRUint32 MAX_MODELVIEW_STACK_DEPTH      = 0x0D36;
-  const PRUint32 MAX_PROJECTION_STACK_DEPTH     = 0x0D38;
-  const PRUint32 MAX_TEXTURE_STACK_DEPTH        = 0x0D39;
-  const PRUint32 MAX_VIEWPORT_DIMS              = 0x0D3A;
-  const PRUint32 MAX_ELEMENTS_VERTICES          = 0x80E8;
-  const PRUint32 MAX_ELEMENTS_INDICES           = 0x80E9;
-  const PRUint32 MAX_TEXTURE_UNITS              = 0x84E2;
-  const PRUint32 SUBPIXEL_BITS                  = 0x0D50;
-  const PRUint32 RED_BITS                       = 0x0D52;
-  const PRUint32 GREEN_BITS                     = 0x0D53;
-  const PRUint32 BLUE_BITS                      = 0x0D54;
-  const PRUint32 ALPHA_BITS                     = 0x0D55;
-  const PRUint32 DEPTH_BITS                     = 0x0D56;
-  const PRUint32 STENCIL_BITS                   = 0x0D57;
-  const PRUint32 POLYGON_OFFSET_UNITS           = 0x2A00;
-  //             POLYGON_OFFSET_FILL            = 0x8037;
-  const PRUint32 POLYGON_OFFSET_FACTOR          = 0x8038;
-  const PRUint32 TEXTURE_BINDING_2D             = 0x8069;
-  const PRUint32 VERTEX_ARRAY_SIZE              = 0x807A;
-  const PRUint32 VERTEX_ARRAY_TYPE              = 0x807B;
-  const PRUint32 VERTEX_ARRAY_STRIDE            = 0x807C;
-  const PRUint32 NORMAL_ARRAY_TYPE              = 0x807E;
-  const PRUint32 NORMAL_ARRAY_STRIDE            = 0x807F;
-  const PRUint32 COLOR_ARRAY_SIZE               = 0x8081;
-  const PRUint32 COLOR_ARRAY_TYPE               = 0x8082;
-  const PRUint32 COLOR_ARRAY_STRIDE             = 0x8083;
-  const PRUint32 TEXTURE_COORD_ARRAY_SIZE       = 0x8088;
-  const PRUint32 TEXTURE_COORD_ARRAY_TYPE       = 0x8089;
-  const PRUint32 TEXTURE_COORD_ARRAY_STRIDE     = 0x808A;
-  const PRUint32 VERTEX_ARRAY_POINTER           = 0x808E;
-  const PRUint32 NORMAL_ARRAY_POINTER           = 0x808F;
-  const PRUint32 COLOR_ARRAY_POINTER            = 0x8090;
-  const PRUint32 TEXTURE_COORD_ARRAY_POINTER    = 0x8092;
-  const PRUint32 SAMPLE_BUFFERS                 = 0x80A8;
-  const PRUint32 SAMPLES                        = 0x80A9;
-  const PRUint32 SAMPLE_COVERAGE_VALUE          = 0x80AA;
-  const PRUint32 SAMPLE_COVERAGE_INVERT         = 0x80AB;
-  /* GetTextureParameter */
-  /*             TEXTURE_MAG_FILTER */
-  /*             TEXTURE_MIN_FILTER */
-  /*             TEXTURE_WRAP_S */
-  /*             TEXTURE_WRAP_T */
-  /* HintMode */
-  const PRUint32 DONT_CARE                      = 0x1100;
-  const PRUint32 FASTEST                        = 0x1101;
-  const PRUint32 NICEST                         = 0x1102;
-  /* HintTarget */
-  const PRUint32 PERSPECTIVE_CORRECTION_HINT    = 0x0C50;
-  const PRUint32 POINT_SMOOTH_HINT              = 0x0C51;
-  const PRUint32 LINE_SMOOTH_HINT               = 0x0C52;
-  const PRUint32 POLYGON_SMOOTH_HINT            = 0x0C53;
-  const PRUint32 FOG_HINT                       = 0x0C54;
-  const PRUint32 GENERATE_MIPMAP_HINT           = 0x8192;
-  /* LightModelParameter */
-  const PRUint32 LIGHT_MODEL_AMBIENT            = 0x0B53;
-  const PRUint32 LIGHT_MODEL_TWO_SIDE           = 0x0B52;
-  const PRUint32 LIGHT_MODEL_LOCAL_VIEWER       = 0x0B51;
-  const PRUint32 LIGHT_MODEL_COLOR_CONTROL      = 0x81F8;
-  /* LightParameter */
-  const PRUint32 AMBIENT                        = 0x1200;
-  const PRUint32 DIFFUSE                        = 0x1201;
-  const PRUint32 SPECULAR                       = 0x1202;
-  const PRUint32 POSITION                       = 0x1203;
-  const PRUint32 SPOT_DIRECTION                 = 0x1204;
-  const PRUint32 SPOT_EXPONENT                  = 0x1205;
-  const PRUint32 SPOT_CUTOFF                    = 0x1206;
-  const PRUint32 CONSTANT_ATTENUATION           = 0x1207;
-  const PRUint32 LINEAR_ATTENUATION             = 0x1208;
-  const PRUint32 QUADRATIC_ATTENUATION          = 0x1209;
-  /* LogicOp */
-  /* CLEAR -> CLEAR_OP, because clear() is a method */
-  const PRUint32 CLEAR_OP                       = 0x1500;
-  const PRUint32 AND                            = 0x1501;
-  const PRUint32 AND_REVERSE                    = 0x1502;
-  const PRUint32 COPY                           = 0x1503;
-  const PRUint32 AND_INVERTED                   = 0x1504;
-  const PRUint32 NOOP                           = 0x1505;
-  const PRUint32 XOR                            = 0x1506;
-  const PRUint32 OR                             = 0x1507;
-  const PRUint32 NOR                            = 0x1508;
-  const PRUint32 EQUIV                          = 0x1509;
-  const PRUint32 INVERT                         = 0x150A;
-  const PRUint32 OR_REVERSE                     = 0x150B;
-  const PRUint32 COPY_INVERTED                  = 0x150C;
-  const PRUint32 OR_INVERTED                    = 0x150D;
-  const PRUint32 NAND                           = 0x150E;
-  const PRUint32 SET                            = 0x150F;
-  /* MaterialFace */
-  /*             FRONT_AND_BACK */
-  /* MaterialParameter */
-  const PRUint32 EMISSION                       = 0x1600;
-  const PRUint32 SHININESS                      = 0x1601;
-  const PRUint32 AMBIENT_AND_DIFFUSE            = 0x1602;
-  /* MatrixMode */
-  const PRUint32 MODELVIEW                      = 0x1700;
-  const PRUint32 PROJECTION                     = 0x1701;
-  const PRUint32 TEXTURE                        = 0x1702;
-  /* LightName */
-  const PRUint32 LIGHT0                         = 0x4000;
-  const PRUint32 LIGHT1                         = 0x4001;
-  const PRUint32 LIGHT2                         = 0x4002;
-  const PRUint32 LIGHT3                         = 0x4003;
-  const PRUint32 LIGHT4                         = 0x4004;
-  const PRUint32 LIGHT5                         = 0x4005;
-  const PRUint32 LIGHT6                         = 0x4006;
-  const PRUint32 LIGHT7                         = 0x4007;
-  /* Shaders */
-  const PRUint32 VERTEX_PROGRAM_POINT_SIZE = 0x8642;
-  const PRUint32 FRAGMENT_SHADER = 0x8B30;
-  const PRUint32 VERTEX_SHADER = 0x8B31;
-  const PRUint32 MAX_VERTEX_ATTRIBS = 0x8869;
-  const PRUint32 MAX_VARYING_FLOATS = 0x8B4B;
-  const PRUint32 MAX_TEXTURE_IMAGE_UNITS = 0x8872;
-  const PRUint32 SHADER_TYPE = 0x8B4F;
-  const PRUint32 FLOAT_VEC2 = 0x8B50;
-  const PRUint32 FLOAT_VEC3 = 0x8B51;
-  const PRUint32 FLOAT_VEC4 = 0x8B52;
-  const PRUint32 INT_VEC2 = 0x8B53;
-  const PRUint32 INT_VEC3 = 0x8B54;
-  const PRUint32 INT_VEC4 = 0x8B55;
-  const PRUint32 BOOL = 0x8B56;
-  const PRUint32 BOOL_VEC2 = 0x8B57;
-  const PRUint32 BOOL_VEC3 = 0x8B58;
-  const PRUint32 BOOL_VEC4 = 0x8B59;
-  const PRUint32 FLOAT_MAT2 = 0x8B5A;
-  const PRUint32 FLOAT_MAT3 = 0x8B5B;
-  const PRUint32 FLOAT_MAT4 = 0x8B5C;
-  const PRUint32 SAMPLER_1D = 0x8B5D;
-  const PRUint32 SAMPLER_2D = 0x8B5E;
-  const PRUint32 SAMPLER_3D = 0x8B5F;
-  const PRUint32 SAMPLER_CUBE = 0x8B60;
-  const PRUint32 SAMPLER_1D_SHADOW = 0x8B61;
-  const PRUint32 SAMPLER_2D_SHADOW = 0x8B62;
-  const PRUint32 DELETE_STATUS = 0x8B80;
-  const PRUint32 LINK_STATUS = 0x8B82;
-  const PRUint32 VALIDATE_STATUS = 0x8B83;
-  const PRUint32 ATTACHED_SHADERS = 0x8B85;
-  const PRUint32 ACTIVE_UNIFORMS = 0x8B86;
-  const PRUint32 ACTIVE_UNIFORM_MAX_LENGTH = 0x8B87;
-  const PRUint32 ACTIVE_ATTRIBUTES = 0x8B89;
-  const PRUint32 CURRENT_PROGRAM = 0x8B8D;
-  /* ShadingModel */
-  const PRUint32 FLAT                           = 0x1D00;
-  const PRUint32 SMOOTH                         = 0x1D01;
-  /* StencilFunction */
-  /*             NEVER */
-  /*             LESS */
-  /*             EQUAL */
-  /*             LEQUAL */
-  /*             GREATER */
-  /*             NOTEQUAL */
-  /*             GEQUAL */
-  /*             ALWAYS */
-  /* StencilOp */
-  /*             ZERO */
-  const PRUint32 KEEP                           = 0x1E00;
-  const PRUint32 REPLACE                        = 0x1E01;
-  const PRUint32 INCR                           = 0x1E02;
-  const PRUint32 DECR                           = 0x1E03;
-  /*             INVERT */
-  /* StringName */
-  const PRUint32 VENDOR                         = 0x1F00;
-  const PRUint32 RENDERER                       = 0x1F01;
-  const PRUint32 VERSION                        = 0x1F02;
-  const PRUint32 EXTENSIONS                     = 0x1F03;
-  /* TextureEnvMode */
-  const PRUint32 MODULATE                       = 0x2100;
-  const PRUint32 DECAL                          = 0x2101;
-  /*             BLEND */
-  const PRUint32 ADD                            = 0x0104;
-  //             REPLACE
-  /*             COMBINE */
-  /* TextureEnvParameter */
-  const PRUint32 TEXTURE_ENV_MODE               = 0x2200;
-  const PRUint32 TEXTURE_ENV_COLOR              = 0x2201;
-  /* TextureEnvTarget */
-  const PRUint32 TEXTURE_ENV                    = 0x2300;
-  /* TextureMagFilter */
-  const PRUint32 NEAREST                        = 0x2600;
-  const PRUint32 LINEAR                         = 0x2601;
-  /* TextureMinFilter */
-  /*             NEAREST */
-  /*             LINEAR */
-  const PRUint32 NEAREST_MIPMAP_NEAREST         = 0x2700;
-  const PRUint32 LINEAR_MIPMAP_NEAREST          = 0x2701;
-  const PRUint32 NEAREST_MIPMAP_LINEAR          = 0x2702;
-  const PRUint32 LINEAR_MIPMAP_LINEAR           = 0x2703;
-  /* TextureParameterName */
-  const PRUint32 TEXTURE_MAG_FILTER             = 0x2800;
-  const PRUint32 TEXTURE_MIN_FILTER             = 0x2801;
-  const PRUint32 TEXTURE_WRAP_S                 = 0x2802;
-  const PRUint32 TEXTURE_WRAP_T                 = 0x2803;
-  const PRUint32 GENERATE_MIPMAP                = 0x8191;
-  /* TextureUnit */
-  const PRUint32 TEXTURE0                       = 0x84C0;
-  const PRUint32 TEXTURE1                       = 0x84C1;
-  const PRUint32 TEXTURE2                       = 0x84C2;
-  const PRUint32 TEXTURE3                       = 0x84C3;
-  const PRUint32 TEXTURE4                       = 0x84C4;
-  const PRUint32 TEXTURE5                       = 0x84C5;
-  const PRUint32 TEXTURE6                       = 0x84C6;
-  const PRUint32 TEXTURE7                       = 0x84C7;
-  const PRUint32 TEXTURE8                       = 0x84C8;
-  const PRUint32 TEXTURE9                       = 0x84C9;
-  const PRUint32 TEXTURE10                      = 0x84CA;
-  const PRUint32 TEXTURE11                      = 0x84CB;
-  const PRUint32 TEXTURE12                      = 0x84CC;
-  const PRUint32 TEXTURE13                      = 0x84CD;
-  const PRUint32 TEXTURE14                      = 0x84CE;
-  const PRUint32 TEXTURE15                      = 0x84CF;
-  const PRUint32 TEXTURE16                      = 0x84D0;
-  const PRUint32 TEXTURE17                      = 0x84D1;
-  const PRUint32 TEXTURE18                      = 0x84D2;
-  const PRUint32 TEXTURE19                      = 0x84D3;
-  const PRUint32 TEXTURE20                      = 0x84D4;
-  const PRUint32 TEXTURE21                      = 0x84D5;
-  const PRUint32 TEXTURE22                      = 0x84D6;
-  const PRUint32 TEXTURE23                      = 0x84D7;
-  const PRUint32 TEXTURE24                      = 0x84D8;
-  const PRUint32 TEXTURE25                      = 0x84D9;
-  const PRUint32 TEXTURE26                      = 0x84DA;
-  const PRUint32 TEXTURE27                      = 0x84DB;
-  const PRUint32 TEXTURE28                      = 0x84DC;
-  const PRUint32 TEXTURE29                      = 0x84DD;
-  const PRUint32 TEXTURE30                      = 0x84DE;
-  const PRUint32 TEXTURE31                      = 0x84DF;
-  const PRUint32 ACTIVE_TEXTURE                 = 0x84E0;
-  const PRUint32 CLIENT_ACTIVE_TEXTURE          = 0x84E1;
-  /* TextureWrapMode */
-  const PRUint32 REPEAT                         = 0x2901;
-  const PRUint32 CLAMP_TO_EDGE                  = 0x812F;
-  /* Texture combine + dot3 */
-  const PRUint32 SUBTRACT                       = 0x84E7;
-  const PRUint32 COMBINE                        = 0x8570;
-  const PRUint32 COMBINE_RGB                    = 0x8571;
-  const PRUint32 COMBINE_ALPHA                  = 0x8572;
-  const PRUint32 RGB_SCALE                      = 0x8573;
-  const PRUint32 ADD_SIGNED                     = 0x8574;
-  const PRUint32 INTERPOLATE                    = 0x8575;
-  const PRUint32 CONSTANT                       = 0x8576;
-  const PRUint32 PRIMARY_COLOR                  = 0x8577;
-  const PRUint32 PREVIOUS                       = 0x8578;
-  const PRUint32 OPERAND0_RGB                   = 0x8590;
-  const PRUint32 OPERAND1_RGB                   = 0x8591;
-  const PRUint32 OPERAND2_RGB                   = 0x8592;
-  const PRUint32 OPERAND0_ALPHA                 = 0x8598;
-  const PRUint32 OPERAND1_ALPHA                 = 0x8599;
-  const PRUint32 OPERAND2_ALPHA                 = 0x859A;
-  const PRUint32 ALPHA_SCALE                    = 0x0D1C;
-  const PRUint32 SRC0_RGB                       = 0x8580;
-  const PRUint32 SRC1_RGB                       = 0x8581;
-  const PRUint32 SRC2_RGB                       = 0x8582;
-  const PRUint32 SRC0_ALPHA                     = 0x8588;
-  const PRUint32 SRC1_ALPHA                     = 0x8589;
-  const PRUint32 SRC2_ALPHA                     = 0x858A;
-  const PRUint32 DOT3_RGB                       = 0x86AE;
-  const PRUint32 DOT3_RGBA                      = 0x86AF;
-  /* Vertex Arrays */
-  const PRUint32 VERTEX_ATTRIB_ARRAY_ENABLED = 0x8622;
-  const PRUint32 VERTEX_ATTRIB_ARRAY_SIZE = 0x8623;
-  const PRUint32 VERTEX_ATTRIB_ARRAY_STRIDE = 0x8624;
-  const PRUint32 VERTEX_ATTRIB_ARRAY_TYPE = 0x8625;
-  const PRUint32 VERTEX_ATTRIB_ARRAY_POINTER = 0x8645;
-  /* Buffers */
-  const PRUint32 STATIC_DRAW                    = 0x88E4;
-  const PRUint32 DYNAMIC_DRAW                   = 0x88E8;
-  const PRUint32 ARRAY_BUFFER                   = 0x8892;
-  const PRUint32 ELEMENT_ARRAY_BUFFER           = 0x8893;
-  const PRUint32 ARRAY_BUFFER_BINDING = 0x8894;
-  const PRUint32 ELEMENT_ARRAY_BUFFER_BINDING = 0x8895;
-  /* Extensions */
-  const PRUint32 TEXTURE_RECTANGLE              = 0x84F5;
-  const PRUint32 TEXTURE_BINDING_RECTANGLE      = 0x84F6;
-  const PRUint32 MAX_RECTANGLE_TEXTURE_SIZE     = 0x84F8;
-  const PRUint32 TEXTURE_MAX_ANISOTROPY         = 0x84FE;
-  const PRUint32 MAX_TEXTURE_MAX_ANISOTROPY     = 0x84FF;
-  // Other
-  void swapBuffers ();
\ No newline at end of file
deleted file mode 100644
--- a/extensions/canvas3d/public/nsICanvasRenderingContextGLBuffer.idl
+++ /dev/null
@@ -1,91 +0,0 @@
-/* -*- Mode: IDL; tab-width: 2; indent-tabs-mode: nil; c-basic-offset: 2 -*- */
-/* ***** BEGIN LICENSE BLOCK *****
- * Version: MPL 1.1/GPL 2.0/LGPL 2.1
- *
- * The contents of this file are subject to the Mozilla Public License Version
- * 1.1 (the "License"); you may not use this file except in compliance with
- * the License. You may obtain a copy of the License at
- *
- *
- * Software distributed under the License is distributed on an "AS IS" basis,
- * WITHOUT WARRANTY OF ANY KIND, either express or implied. See the License
- * for the specific language governing rights and limitations under the
- * License.
- *
- * The Original Code is canvas 3D.
- *
- * The Initial Developer of the Original Code is
- *   Mozilla Corporation.
- * Portions created by the Initial Developer are Copyright (C) 2007
- * the Initial Developer. All Rights Reserved.
- *
- * Contributor(s):
- *   Vladimir Vukicevic <>
- *
- * Alternatively, the contents of this file may be used under the terms of
- * either of the GNU General Public License Version 2 or later (the "GPL"),
- * or the GNU Lesser General Public License Version 2.1 or later (the "LGPL"),
- * in which case the provisions of the GPL or the LGPL are applicable instead
- * of those above. If you wish to allow use of your version of this file only
- * under the terms of either the GPL or the LGPL, and not to allow others to
- * use your version of this file under the terms of the MPL, indicate your
- * decision by deleting the provisions above and replace them with the notice
- * and other provisions required by the GPL or the LGPL. If you do not delete
- * the provisions above, a recipient may use your version of this file under
- * the terms of any one of the MPL, the GPL or the LGPL.
- *
- * ***** END LICENSE BLOCK ***** */
-#include "nsISupports.idl"
-interface nsICanvasRenderingContextGL;
-[scriptable, uuid(14eb51cd-febe-41fa-b833-4c599719121e)]
-interface nsICanvasRenderingContextGLBuffer : nsISupports
-  readonly attribute nsICanvasRenderingContextGL ownerContext;
-  readonly attribute PRBool disposed;
-  // immediately free the memory held by this buffer,
-  // even before this object is destroyed (e.g. by the JS GC)
-  void dispose();
-  readonly attribute PRUint32 usage;  // either STATIC_DRAW or DYNAMIC_DRAW
-  readonly attribute PRUint32 length; // number of elements
-  readonly attribute PRUint32 type;   // type of each element
-[scriptable, uuid(27a45ca4-0847-4f2e-8e32-6d4966ff3e56)]
-interface nsICanvasRenderingContextGLTexture : nsISupports
-  readonly attribute nsICanvasRenderingContextGL ownerContext;
-  readonly attribute PRBool disposed;
-  const PRUint32 TARGET_2D = 0;
-  const PRUint32 TARGET_RECT = 1;
-  readonly attribute PRUint32 target;
-  // in pixels; the texture coordinates
-  // are 0..w/h for TARGET_RECT, or 0.0 .. 1.0
-  // for TARGET_2D
-  readonly attribute PRUint32 width;
-  readonly attribute PRUint32 height;
-  const PRUint32 FILTER_TYPE_MAG = 0;
-  const PRUint32 FILTER_TYPE_MIN = 1;
-  const PRUint32 FILTER_NEAREST = 0;
-  const PRUint32 FILTER_LINER = 1;
-  void setFilter (in PRUint32 filterType, in PRUint32 filterMode);
-  const PRUint32 WRAP_TYPE_S = 0;
-  const PRUint32 WRAP_TYPE_T = 0;
-  const PRUint32 WRAP_CLAMP_TO_EDGE = 1;
-  const PRUint32 WRAP_REPEAT = 3;
-  const PRUint32 WRAP_MIRRORED_REPEAT = 4;
-  void setWrap (in PRUint32 wrapType, in PRUint32 wrapMode);
deleted file mode 100644
--- a/extensions/canvas3d/public/nsICanvasRenderingContextGLES11.idl
+++ /dev/null
@@ -1,217 +0,0 @@
-/* -*- Mode: IDL; tab-width: 2; indent-tabs-mode: nil; c-basic-offset: 2 -*- */
-/* ***** BEGIN LICENSE BLOCK *****
- * Version: MPL 1.1/GPL 2.0/LGPL 2.1
- *
- * The contents of this file are subject to the Mozilla Public License Version
- * 1.1 (the "License"); you may not use this file except in compliance with
- * the License. You may obtain a copy of the License at
- *
- *
- * Software distributed under the License is distributed on an "AS IS" basis,
- * WITHOUT WARRANTY OF ANY KIND, either express or implied. See the License
- * for the specific language governing rights and limitations under the
- * License.
- *
- * The Original Code is canvas 3D.
- *
- * The Initial Developer of the Original Code is
- *   Mozilla Corporation.
- * Portions created by the Initial Developer are Copyright (C) 2006
- * the Initial Developer. All Rights Reserved.
- *
- * Contributor(s):
- *   Vladimir Vukicevic <>
- *
- * Alternatively, the contents of this file may be used under the terms of
- * either of the GNU General Public License Version 2 or later (the "GPL"),
- * or the GNU Lesser General Public License Version 2.1 or later (the "LGPL"),
- * in which case the provisions of the GPL or the LGPL are applicable instead
- * of those above. If you wish to allow use of your version of this file only
- * under the terms of either the GPL or the LGPL, and not to allow others to
- * use your version of this file under the terms of the MPL, indicate your
- * decision by deleting the provisions above and replace them with the notice
- * and other provisions required by the GPL or the LGPL. If you do not delete
- * the provisions above, a recipient may use your version of this file under
- * the terms of any one of the MPL, the GPL or the LGPL.
- *
- * ***** END LICENSE BLOCK ***** */
-#include "nsICanvasRenderingContextGL.idl"
-#include "nsICanvasRenderingContextGLBuffer.idl"
-interface nsIDOMHTMLElement;
-interface nsIDOMHTMLCanvasElement;
-[scriptable, uuid(619a102d-6c58-4660-ba35-60d9b8de92ab)]
-interface nsICanvasRenderingContextGLES11 : nsICanvasRenderingContextGL
-  /**
-   ** GL ES 1.1 API
-   **
-   ** Section numbers refer to the GL ES Common/Common-Lite Profile Specification 1.0 document
-   **/
-  void enable (in PRUint32 mode);
-  void disable (in PRUint32 mode);
-  void clientActiveTexture (in PRUint32 texture);
-  void enableClientState (in PRUint32 mode);
-  void disableClientState (in PRUint32 mode);
-  // 2.5 GL Errors
-  PRUint32 getError ();
-  // 2.7 Vertex Specification
-  void normal (in float nx, in float ny, in float nz);
-  void multiTexCoord (in PRUint32 target, in float s, in float t, in float r, in float q);
-  void color (in float r, in float g, in float b, in float a);
-  // 2.8 Vertex Arrays
-  // Note: these are handled via scriptable helpers to avoid unnencessary type conversions
-  //X void vertexPointer (in PRUint8 size, in PRUint32 type, in object [] vertexArray);
-  void vertexPointer ();
-  //X void normalPointer (in PRUint32 type, in object [] normalArray);
-  void normalPointer ();
-  //X void texCoordPointer (in PRUint8 size, in PRUint32 type, in object [] texCoordArray);
-  void texCoordPointer ();
-  //X void colorPointer (in PRUint8 size, in PRUint32 type, in object [] colorArray);
-  void colorPointer ();
-  //X void drawElements (in PRUint32 mode, in PRUint32 count, in PRUint32 type, in object [] indices);
-  void drawElements ();
-  void drawArrays (in PRUint32 mode, in PRUint32 first, in PRUint32 count);
-  // 2.9 Buffer Objects
-  void genBuffers (in PRUint32 n);
-  /* [array of buffers] */
-  void deleteBuffers ();
-  void bindBuffer (in PRUint32 target, in PRUint32 buffer);
-  /* array, type, usage */
-  void bufferData ();
-  /* offset, array, type */
-  void bufferSubData ();
-  // JS buffer objects; will use buffer objects extension if available,
-  // otherwise will just store in client memeory
-  //void bindBufferObject (in PRUint32 target, in nsICanvasRenderingContextGLES11Buffer obj);
-  //X nsICanvasRenderingContextGLES11Buffer
-  //X   createBuffer(in PRInt32 usage, in PRInt32 componentSize, in PRInt32 type, in [] array);
-  nsICanvasRenderingContextGLBuffer createBuffer();
-  // 2.11 Coordinate Transformations
-  void depthRange (in float zNear, in float zFar);
-  void viewport (in PRInt32 x, in PRInt32 y, in PRInt32 width, in PRInt32 height);
-  void matrixMode (in PRUint32 mode);
-  //X void loadMatrix (in float [] matrix);
-  void loadMatrix ();
-  //X void multMatrix (in float [] matrix);
-  void multMatrix ();
-  void loadIdentity ();
-  void rotate (in float angle, in float x, in float y, in float z);
-  void scale (in float x, in float y, in float z);
-  void translate (in float x, in float y, in float z);
-  void frustum (in float left, in float right, in float bottom, in float top, in float zNear, in float zFar);
-  void ortho (in float left, in float right, in float bottom, in float top, in float zNear, in float zFar);
-  void pushMatrix ();
-  void popMatrix ();
-  // 2.12 Clipping
-  //void clipPlane (in PRUint32 plane, in float [] equation);
-  //void getClipPlane (in PRUint32 pname, out float [] equation);
-  // 2.14 Colors and Coloring
-  void frontFace (in PRUint32 face);
-  void material ();
-  void getMaterial ();
-  void light ();
-  void getLight ();
-  void lightModel ();
-  void shadeModel (in PRUint32 pname);
-  // 3.3 Points
-  void pointSize (in float size);
-  void pointParameter ();
-  void lineWidth (in float width);
-  // 3.5 Polygons
-  void cullFace (in PRUint32 mode);
-  void polygonOffset (in float factor, in float units);
-  // 3.6 Pixel Rectangles
-  // glReadPixels is not supported (XXX well, it might be)
-  // and TexImage2D behaves differently, so no need for PixelStore[i]
-  // 3.8.5 Texture State
-  void activeTexture (in PRUint32 texture);
-  nsICanvasRenderingContextGLTexture createTextureObject (in nsIDOMHTMLElement imageOrCanvas);
-  void bindTextureObject (in nsICanvasRenderingContextGLTexture texture);
-  void deleteTextureObject (in nsICanvasRenderingContextGLTexture texture);
-  // This needs some work; we need to allow specifying the internal format, so that
-  // we can load A/L/LA images as well as RGB/RGBA, which is all we'd get from a DOM Image
-  void texImage2DHTML (in PRUint32 target, in nsIDOMHTMLElement imageOrCanvas);
-  //void texSubImage2DHTML (...);
-  void texParameter();
-  void getTexParameter();
-  void bindTexture (in PRUint32 target, in PRUint32 texid);
-  void deleteTextures ();
-  void genTextures (in PRUint32 n);
-  //boolean isTexture (in PRUint32 texture);
-  void texEnv();
-  void getTexEnv();
-  // 3.9 Fog
-  //X (this is called glFog{fi}[v], but we can't call it "fog" because
-  //   we have FOG as a glEnable const already)
-  void fogParameter ();
-  // 4.1 Per-Fragment Operations
-  void scissor (in PRInt32 x, in PRInt32 y, in PRInt32 width, in PRInt32 height);
-  void sampleCoverage (in float value, in boolean invert);
-  void alphaFunc (in PRUint32 func, in float ref);
-  void stencilFunc (in PRUint32 func, in PRInt32 ref, in PRUint32 mask);
-  void stencilMask (in PRUint32 mask);
-  void stencilOp (in PRUint32 fail, in PRUint32 zfail, in PRUint32 zpass);
-  void depthFunc (in PRUint32 func);
-  void depthMask (in boolean flag);
-  void blendFunc (in PRUint32 sfactor, in PRUint32 dfactor);
-  void logicOp (in PRUint32 opcode);
-  // 4.2 Whole Framebuffer Operations
-  void colorMask (in boolean red, in boolean green, in boolean blue, in boolean alpha);
-  void clear (in PRUint32 mask);
-  void clearColor (in float red, in float green, in float blue, in float alpha);
-  void clearDepth (in float depth);
-  void clearStencil (in PRInt32 s);
-  // 4.3 Drawing, Reading, and Copying Pixels
-  // we should support ReadPixels at some point
-  // 5.5 Flush and Finish
-  // I'm not sure if this is useful for our purposes; we can't block the UI, soo...
-  // 5.6 Hints
-  void hint (in PRUint32 target, in PRUint32 mode);
-  // 6.1 Querying GL State
-  // getBooleanv, getIntegerv, getFloatv, getDoublev, getString
-  // are all rolled into a single function that uses scriptable
-  // magic to return the right type of jsobj.  Colors are always
-  // returned as normalized floats (0.0 .. 1.0).
-  void getParameter (in PRUint32 pname);
-  // More other
-  void gluPerspective (in float fovy, in float aspect, in float znear, in float zfar);
-  void gluLookAt (in float eyex, in float eyey, in float eyez,
-                  in float ctrx, in float ctry, in float ctrz,
-                  in float upx, in float upy, in float upz);
deleted file mode 100644
--- a/extensions/canvas3d/public/nsICanvasRenderingContextGLWeb20.idl
+++ /dev/null
@@ -1,185 +0,0 @@
-/* -*- Mode: IDL; tab-width: 2; indent-tabs-mode: nil; c-basic-offset: 2 -*- */
-/* ***** BEGIN LICENSE BLOCK *****
- * Version: MPL 1.1/GPL 2.0/LGPL 2.1
- *
- * The contents of this file are subject to the Mozilla Public License Version
- * 1.1 (the "License"); you may not use this file except in compliance with
- * the License. You may obtain a copy of the License at
- *
- *
- * Software distributed under the License is distributed on an "AS IS" basis,
- * WITHOUT WARRANTY OF ANY KIND, either express or implied. See the License
- * for the specific language governing rights and limitations under the
- * License.
- *
- * The Original Code is canvas 3D.
- *
- * The Initial Developer of the Original Code is
- *   Mozilla Corporation.
- * Portions created by the Initial Developer are Copyright (C) 2006
- * the Initial Developer. All Rights Reserved.
- *
- * Contributor(s):
- *   Vladimir Vukicevic <>
- *
- * Alternatively, the contents of this file may be used under the terms of
- * either of the GNU General Public License Version 2 or later (the "GPL"),
- * or the GNU Lesser General Public License Version 2.1 or later (the "LGPL"),
- * in which case the provisions of the GPL or the LGPL are applicable instead
- * of those above. If you wish to allow use of your version of this file only
- * under the terms of either the GPL or the LGPL, and not to allow others to
- * use your version of this file under the terms of the MPL, indicate your
- * decision by deleting the provisions above and replace them with the notice
- * and other provisions required by the GPL or the LGPL. If you do not delete
- * the provisions above, a recipient may use your version of this file under
- * the terms of any one of the MPL, the GPL or the LGPL.
- *
- * ***** END LICENSE BLOCK ***** */
-#include "nsICanvasRenderingContextGL.idl"
-#include "nsICanvasRenderingContextGLBuffer.idl"
-interface nsIDOMHTMLElement;
-[scriptable, uuid(209a9c93-495e-4085-a3e4-29354b404cc4)]
-interface nsICanvasRenderingContextGLWeb20 : nsICanvasRenderingContextGL
-  void activeTexture (in PRUint32 texture);
-  void attachShader (in PRUint32 program, in PRUint32 shader);
-  void bindAttribLocation (in PRUint32 program, in PRUint32 index, in string name);
-  void bindBuffer (in PRUint32 target, in PRUint32 buffer);
-  void bindTexture (in PRUint32 target, in PRUint32 texid);
-  void blendColor (in float red, in float green, in float blue, in float alpha);
-  void blendEquation (in PRUint32 mode);
-  void blendEquationSeparate (in PRUint32 modeRGB, in PRUint32 modeAlpha);
-  void blendFunc (in PRUint32 sfactor, in PRUint32 dfactor);
-  void blendFuncSeparate (in PRUint32 srcRGB, in PRUint32 dstRGB, in PRUint32 srcAlpha, in PRUint32 dstAlpha);
-  /* array, type, usage */
-  void bufferData ();
-  /* offset, array, type */
-  void bufferSubData ();
-  void clear (in PRUint32 mask);
-  void clearColor (in float red, in float green, in float blue, in float alpha);
-  void clearDepth (in float depth);
-  void clearStencil (in PRInt32 s);
-  void colorMask (in boolean red, in boolean green, in boolean blue, in boolean alpha);
-  // NO compressedTexImage2D
-  // NO compressedTexSubImage2D
-  // YES copyTexImage2D
-  PRUint32 createProgram ();
-  PRUint32 createShader (in PRUint32 type);
-  void cullFace (in PRUint32 face);
-  /* [array of buffers] */
-  void deleteBuffers ();
-  void deleteTextures ();
-  void deleteProgram (in PRUint32 program);
-  void deleteShader (in PRUint32 shader);
-  void detachShader (in PRUint32 program, in PRUint32 shader);
-  void depthFunc (in PRUint32 func);
-  void depthMask (in boolean flag);
-  void depthRange (in float zNear, in float zFar);
-  void disable (in PRUint32 mode);
-  void disableVertexAttribArray (in PRUint32 index);
-  void drawArrays (in PRUint32 mode, in PRUint32 first, in PRUint32 count);
-  void drawElements ();
-  void enable (in PRUint32 mode);
-  void enableVertexAttribArray (in PRUint32 index);
-  // NO Finish
-  // NO Flush
-  void frontFace (in PRUint32 face);
-  // getActiveAttrib returns an object: { name: "..", size: .., type: .. }
-  void getActiveAttrib (in PRUint32 program, in PRUint32 index);
-  // getActiveUniform returns an object: { name: "..", size: .., type: .. }
-  void getActiveUniform (in PRUint32 program, in PRUint32 index);
-  // returns an array of shader IDs
-  void getAttachedShaders (in PRUint32 program);
-  PRInt32 getAttribLocation (in PRUint32 program, in string name);
-  // getBooleanv, getIntegerv, getFloatv, getDoublev, getString
-  // are all rolled into a single function that uses scriptable
-  // magic to return the right type of jsobj.  Colors are always
-  // returned as normalized floats (0.0 .. 1.0).
-  void getParameter (in PRUint32 pname);
-  void getBufferParameter (in PRUint32 target, in PRUint32 pname);
-  void genBuffers (in PRUint32 n);
-  void genTextures (in PRUint32 n);
-  PRUint32 getError ();
-  void getProgramParameter (in PRUint32 program, in PRUint32 pname);
-  string getProgramInfoLog (in PRUint32 program);
-  void getTexParameter(in PRUint32 target, in PRUint32 pname);
-  void getUniform (in PRUint32 program, in PRUint32 location);
-  PRInt32 getUniformLocation (in PRUint32 program, in string name);
-  void getVertexAttrib (in PRUint32 index, in PRUint32 pname);
-  // NO void getVertexAttribPointerv 
-  void hint (in PRUint32 target, in PRUint32 mode);
-  boolean isBuffer (in PRUint32 buffer);
-  boolean isEnabled (in PRUint32 cap);
-  boolean isProgram (in PRUint32 program);
-  boolean isShader (in PRUint32 shader);
-  boolean isTexture (in PRUint32 texture);
-  void lineWidth (in float width);
-  void linkProgram (in PRUint32 program);
-  // nO pixelStore
-  void polygonOffset (in float factor, in float units);
-  // NO readPixels
-  void sampleCoverage (in float value, in boolean invert);
-  void scissor (in PRInt32 x, in PRInt32 y, in PRInt32 width, in PRInt32 height);
-  void stencilFunc (in PRUint32 func, in PRInt32 ref, in PRUint32 mask);
-  void stencilFuncSeparate (in PRUint32 face, in PRUint32 func, in PRInt32 ref, in PRUint32 mask);
-  void stencilMask (in PRUint32 mask);
-  void stencilMaskSeparate (in PRUint32 face, in PRUint32 mask);
-  void stencilOp (in PRUint32 fail, in PRUint32 zfail, in PRUint32 zpass);
-  void stencilOpSeparate (in PRUint32 face, in PRUint32 fail, in PRUint32 zfail, in PRUint32 zpass);
-  void texImage2DHTML (in PRUint32 target, in nsIDOMHTMLElement imageOrCanvas);
-  void texParameter();
-  // YES void texSubImage2DHTML (...);
-  // need better names for this
-  void uniformi();
-  void uniformf();
-  void uniformMatrix();
-  void useProgram (in PRUint32 program);
-  void validateProgram (in PRUint32 program);
-  void vertexAttrib ();
-  void vertexAttribPointer ();
-  void viewport (in PRInt32 x, in PRInt32 y, in PRInt32 width, in PRInt32 height);
-  void compileShader (in PRUint32 shader);
-  void getShaderParameter (in PRUint32 shader, in PRUint32 pname);
-  string getShaderInfoLog (in PRUint32 shader);
-  string getShaderSource (in PRUint32 shader);
-  void shaderSource(in PRUint32 shader, in string source);
\ No newline at end of file
deleted file mode 100644
--- a/extensions/canvas3d/resources/content/options.xul
+++ /dev/null
@@ -1,14 +0,0 @@
-<?xml version="1.0"?>
-<?xml-stylesheet href="chrome://global/skin/global.css" type="text/css"?>
-<prefwindow id="canvas3d-options" xmlns="">
-  <prefpane>
-    <preferences>
-      <preference id="webcontent" name="extensions.canvas3d.enabledForWebContent" type="bool"/>
-    </preferences>
-    <checkbox label="Enable 3D canvas in web content" preference="webcontent"/>
-  </prefpane>
deleted file mode 100644
--- a/extensions/canvas3d/src/
+++ /dev/null
@@ -1,142 +0,0 @@
-# ***** BEGIN LICENSE BLOCK *****
-# Version: MPL 1.1/GPL 2.0/LGPL 2.1
-# The contents of this file are subject to the Mozilla Public License Version
-# 1.1 (the "License"); you may not use this file except in compliance with
-# the License. You may obtain a copy of the License at
-# Software distributed under the License is distributed on an "AS IS" basis,
-# WITHOUT WARRANTY OF ANY KIND, either express or implied. See the License
-# for the specific language governing rights and limitations under the
-# License.
-# The Original Code is canvas code.
-# The Initial Developer of the Original Code is
-#   Mozilla
-# Portions created by the Initial Developer are Copyright (C) 2006
-# the Initial Developer. All Rights Reserved.
-# Contributor(s):
-#   Vladimir Vukicevic <>
-# Alternatively, the contents of this file may be used under the terms of
-# either of the GNU General Public License Version 2 or later (the "GPL"),
-# or the GNU Lesser General Public License Version 2.1 or later (the "LGPL"),
-# in which case the provisions of the GPL or the LGPL are applicable instead
-# of those above. If you wish to allow use of your version of this file only
-# under the terms of either the GPL or the LGPL, and not to allow others to
-# use your version of this file under the terms of the MPL, indicate your
-# decision by deleting the provisions above and replace them with the notice
-# and other provisions required by the GPL or the LGPL. If you do not delete
-# the provisions above, a recipient may use your version of this file under
-# the terms of any one of the MPL, the GPL or the LGPL.
-# ***** END LICENSE BLOCK *****
-DEPTH            = ../../..
-topsrcdir        = @top_srcdir@
-srcdir           = @srcdir@
-VPATH            = @srcdir@
-include $(DEPTH)/config/
-MODULE		= canvas3d
-LIBRARY_NAME	= canvas3d
-XPI_NAME	= canvas3d
-MODULE_NAME	= nsCanvas3DModule
-		xpcom \
-		string \
-		unicharutil \
-		xpconnect \
-		thebes \
-		cairo \
-		content \
-		dom \
-		caps \
-		js \
-		imglib2 \
-		necko \
-		gfx \
-		layout \
-		widget \
-		locale \
-		pref \
-		view \
-		$(NULL)
-ifdef MOZ_X11
-ifeq ($(MOZ_WIDGET_TOOLKIT),windows)
-# nothing
-ifneq (,$(filter $(MOZ_WIDGET_TOOLKIT),mac cocoa))
-# nothing
-CSRCS		= glew.c \
-		  $(NULL)
-CPPSRCS		= nsCanvas3DModule.cpp \
-		  nsCanvasRenderingContextGL.cpp \
-		  nsCanvasRenderingContextGLES11.cpp \
-		  nsCanvasRenderingContextGLWeb20.cpp \
-		  nsGLPbuffer.cpp \
-		  $(NULL)
-EXTRA_DSO_LIBS += xpcom
- ifneq ($(MOZ_WIDGET_TOOLKIT),cocoa)
- endif
-EXTRA_DSO_LIBS += thebes
-# Hack for getting an extension built against static vs. dynamic versions of firefox
-##ifeq (,$(BUILD_STATIC_LIBS))
-#EXTRA_DSO_LIBS += gkgfx
-include $(topsrcdir)/config/
-LOCAL_INCLUDES	+= -I$(srcdir)
-ifdef MOZ_X11
-ifeq ($(MOZ_WIDGET_TOOLKIT),windows)
-EXTRA_DSO_LDOPTS += opengl32.lib glu32.lib usp10.lib
-ifeq ($(MOZ_WIDGET_TOOLKIT),cocoa)
-EXTRA_DSO_LDOPTS += -framework AGL -framework OpenGL
- endif
deleted file mode 100644
--- a/extensions/canvas3d/src/glew.c
+++ /dev/null
@@ -1,9760 +0,0 @@
-** The OpenGL Extension Wrangler Library
-** Copyright (C) 2002-2006, Milan Ikits <milan ikits[]ieee org>
-** Copyright (C) 2002-2006, Marcelo E. Magallon <mmagallo[]debian org>
-** Copyright (C) 2002, Lev Povalahev
-** All rights reserved.
-** Redistribution and use in source and binary forms, with or without 
-** modification, are permitted provided that the following conditions are met:
-** * Redistributions of source code must retain the above copyright notice, 
-**   this list of conditions and the following disclaimer.
-** * Redistributions in binary form must reproduce the above copyright notice, 
-**   this list of conditions and the following disclaimer in the documentation 
-**   and/or other materials provided with the distribution.
-** * The name of the author may be used to endorse or promote products 
-**   derived from this software without specific prior written permission.
-#include "glew.h"
-#if defined(_WIN32)
-#  include "wglew.h"
-#elif !defined(__APPLE__) || defined(GLEW_APPLE_GLX)
-#  include "glxew.h"
- * Define glewGetContext and related helper macros.
- */
-#ifdef GLEW_MX
-#  define glewGetContext() ctx
-#  ifdef _WIN32
-#    define GLEW_CONTEXT_ARG_DEF_INIT GLEWContext* ctx
-#    define GLEW_CONTEXT_ARG_VAR_INIT ctx
-#    define wglewGetContext() ctx
-#    define WGLEW_CONTEXT_ARG_DEF_INIT WGLEWContext* ctx
-#    define WGLEW_CONTEXT_ARG_DEF_LIST WGLEWContext* ctx
-#  else /* _WIN32 */
-#    define GLEW_CONTEXT_ARG_DEF_INIT void
-#    define glxewGetContext() ctx
-#    define GLXEW_CONTEXT_ARG_DEF_INIT void
-#    define GLXEW_CONTEXT_ARG_DEF_LIST GLXEWContext* ctx
-#  endif /* _WIN32 */
-#  define GLEW_CONTEXT_ARG_DEF_LIST GLEWContext* ctx
-#else /* GLEW_MX */
-#endif /* GLEW_MX */
-#if defined(__APPLE__)
-#include <mach-o/dyld.h>
-#include <stdlib.h>
-#include <string.h>
-void* NSGLGetProcAddress (const GLubyte *name)
-  NSSymbol symbol;
-  char* symbolName;
-  /* prepend a '_' for the Unix C symbol mangling convention */
-  symbolName = malloc(strlen((const char*)name) + 2);
-  strcpy(symbolName+1, (const char*)name);
-  symbolName[0] = '_';
-  symbol = NULL;
-  if (NSIsSymbolNameDefined(symbolName))
-    symbol = NSLookupAndBindSymbol(symbolName);
-  free(symbolName);
-  return symbol ? NSAddressOfSymbol(symbol) : NULL;
-#endif /* __APPLE__ */
-#if defined(__sgi) || defined (__sun)
-#include <dlfcn.h>
-#include <stdio.h>
-#include <stdlib.h>
-void* dlGetProcAddress (const GLubyte* name)
-  static void* h = NULL;
-  static void* gpa;
-  if (h == NULL)
-  {
-    if ((h = dlopen(NULL, RTLD_LAZY | RTLD_LOCAL)) == NULL) return NULL;
-    gpa = dlsym(h, "glXGetProcAddress");
-  }
-  if (gpa != NULL)
-    return ((void*(*)(const GLubyte*))gpa)(name);
-  else
-    return dlsym(h, (const char*)name);
-#endif /* __sgi || __sun */
- * Define glewGetProcAddress.
- */
-#if defined(_WIN32)
-#  define glewGetProcAddress(name) wglGetProcAddress((LPCSTR)name)
-#  if defined(__APPLE__)
-#    define glewGetProcAddress(name) NSGLGetProcAddress(name)
-#  else
-#    if defined(__sgi) || defined(__sun)
-#      define glewGetProcAddress(name) dlGetProcAddress(name)
-#    else /* __linux */
-#      define glewGetProcAddress(name) (*glXGetProcAddressARB)(name)
-#    endif
-#  endif
- * GLEW, just like OpenGL or GLU, does not rely on the standard C library.
- * These functions implement the functionality required in this file.
- */
-static GLuint _glewStrLen (const GLubyte* s)
-  GLuint i=0;
-  if (s == NULL) return 0;
-  while (s[i] != '\0') i++;
-  return i;
-static GLuint _glewStrCLen (const GLubyte* s, GLubyte c)
-  GLuint i=0;
-  if (s == NULL) return 0;
-  while (s[i] != '\0' && s[i] != c) i++;
-  return s[i] == c ? i : 0;
-static GLboolean _glewStrSame (const GLubyte* a, const GLubyte* b, GLuint n)
-  GLuint i=0;
-  if(a == NULL || b == NULL)
-    return (a == NULL && b == NULL && n == 0) ? GL_TRUE : GL_FALSE;
-  while (i < n && a[i] != '\0' && b[i] != '\0' && a[i] == b[i]) i++;
-  return i == n ? GL_TRUE : GL_FALSE;
-static GLboolean _glewStrSame1 (GLubyte** a, GLuint* na, const GLubyte* b, GLuint nb)
-  while (*na > 0 && (**a == ' ' || **a == '\n' || **a == '\r' || **a == '\t'))
-  {
-    (*a)++;
-    (*na)--;
-  }
-  if(*na >= nb)
-  {
-    GLuint i=0;
-    while (i < nb && (*a)+i != NULL && b+i != NULL && (*a)[i] == b[i]) i++;
-	if(i == nb)
-	{
-		*a = *a + nb;
-		*na = *na - nb;
-		return GL_TRUE;
-	}
-  }
-  return GL_FALSE;
-static GLboolean _glewStrSame2 (GLubyte** a, GLuint* na, const GLubyte* b, GLuint nb)
-  if(*na >= nb)
-  {
-    GLuint i=0;
-    while (i < nb && (*a)+i != NULL && b+i != NULL && (*a)[i] == b[i]) i++;
-	if(i == nb)
-	{
-		*a = *a + nb;
-		*na = *na - nb;
-		return GL_TRUE;
-	}
-  }
-  return GL_FALSE;
-static GLboolean _glewStrSame3 (GLubyte** a, GLuint* na, const GLubyte* b, GLuint nb)
-  if(*na >= nb)
-  {
-    GLuint i=0;
-    while (i < nb && (*a)+i != NULL && b+i != NULL && (*a)[i] == b[i]) i++;
-    if (i == nb && (*na == nb || (*a)[i] == ' ' || (*a)[i] == '\n' || (*a)[i] == '\r' || (*a)[i] == '\t'))
-    {
-      *a = *a + nb;
-      *na = *na - nb;
-      return GL_TRUE;
-    }
-  }
-  return GL_FALSE;
-#if !defined(_WIN32) || !defined(GLEW_MX)
-#endif /* !WIN32 || !GLEW_MX */
-#if !defined(GLEW_MX)
-GLboolean __GLEW_VERSION_1_1 = GL_FALSE;
-GLboolean __GLEW_VERSION_1_2 = GL_FALSE;
-GLboolean __GLEW_VERSION_1_3 = GL_FALSE;
-GLboolean __GLEW_VERSION_1_4 = GL_FALSE;
-GLboolean __GLEW_VERSION_1_5 = GL_FALSE;
-GLboolean __GLEW_VERSION_2_0 = GL_FALSE;
-GLboolean __GLEW_3DFX_multisample = GL_FALSE;
-GLboolean __GLEW_3DFX_tbuffer = GL_FALSE;
-GLboolean __GLEW_3DFX_texture_compression_FXT1 = GL_FALSE;
-GLboolean __GLEW_APPLE_client_storage = GL_FALSE;
-GLboolean __GLEW_APPLE_element_array = GL_FALSE;
-GLboolean __GLEW_APPLE_fence = GL_FALSE;
-GLboolean __GLEW_APPLE_float_pixels = GL_FALSE;
-GLboolean __GLEW_APPLE_pixel_buffer = GL_FALSE;
-GLboolean __GLEW_APPLE_specular_vector = GL_FALSE;
-GLboolean __GLEW_APPLE_texture_range = GL_FALSE;
-GLboolean __GLEW_APPLE_transform_hint = GL_FALSE;
-GLboolean __GLEW_APPLE_vertex_array_object = GL_FALSE;
-GLboolean __GLEW_APPLE_vertex_array_range = GL_FALSE;
-GLboolean __GLEW_APPLE_ycbcr_422 = GL_FALSE;
-GLboolean __GLEW_ARB_color_buffer_float = GL_FALSE;
-GLboolean __GLEW_ARB_depth_texture = GL_FALSE;
-GLboolean __GLEW_ARB_draw_buffers = GL_FALSE;
-GLboolean __GLEW_ARB_fragment_program = GL_FALSE;
-GLboolean __GLEW_ARB_fragment_program_shadow = GL_FALSE;
-GLboolean __GLEW_ARB_fragment_shader = GL_FALSE;
-GLboolean __GLEW_ARB_half_float_pixel = GL_FALSE;
-GLboolean __GLEW_ARB_imaging = GL_FALSE;
-GLboolean __GLEW_ARB_matrix_palette = GL_FALSE;
-GLboolean __GLEW_ARB_multisample = GL_FALSE;
-GLboolean __GLEW_ARB_multitexture = GL_FALSE;
-GLboolean __GLEW_ARB_occlusion_query = GL_FALSE;
-GLboolean __GLEW_ARB_pixel_buffer_object = GL_FALSE;
-GLboolean __GLEW_ARB_point_parameters = GL_FALSE;
-GLboolean __GLEW_ARB_point_sprite = GL_FALSE;
-GLboolean __GLEW_ARB_shader_objects = GL_FALSE;
-GLboolean __GLEW_ARB_shading_language_100 = GL_FALSE;
-GLboolean __GLEW_ARB_shadow = GL_FALSE;
-GLboolean __GLEW_ARB_shadow_ambient = GL_FALSE;
-GLboolean __GLEW_ARB_texture_border_clamp = GL_FALSE;
-GLboolean __GLEW_ARB_texture_compression = GL_FALSE;
-GLboolean __GLEW_ARB_texture_cube_map = GL_FALSE;
-GLboolean __GLEW_ARB_texture_env_add = GL_FALSE;
-GLboolean __GLEW_ARB_texture_env_combine = GL_FALSE;
-GLboolean __GLEW_ARB_texture_env_crossbar = GL_FALSE;
-GLboolean __GLEW_ARB_texture_env_dot3 = GL_FALSE;
-GLboolean __GLEW_ARB_texture_float = GL_FALSE;
-GLboolean __GLEW_ARB_texture_mirrored_repeat = GL_FALSE;
-GLboolean __GLEW_ARB_texture_non_power_of_two = GL_FALSE;
-GLboolean __GLEW_ARB_texture_rectangle = GL_FALSE;
-GLboolean __GLEW_ARB_transpose_matrix = GL_FALSE;
-GLboolean __GLEW_ARB_vertex_blend = GL_FALSE;
-GLboolean __GLEW_ARB_vertex_buffer_object = GL_FALSE;
-GLboolean __GLEW_ARB_vertex_program = GL_FALSE;
-GLboolean __GLEW_ARB_vertex_shader = GL_FALSE;
-GLboolean __GLEW_ARB_window_pos = GL_FALSE;
-GLboolean __GLEW_ATIX_point_sprites = GL_FALSE;
-GLboolean __GLEW_ATIX_texture_env_combine3 = GL_FALSE;
-GLboolean __GLEW_ATIX_texture_env_route = GL_FALSE;
-GLboolean __GLEW_ATIX_vertex_shader_output_point_size = GL_FALSE;
-GLboolean __GLEW_ATI_draw_buffers = GL_FALSE;
-GLboolean __GLEW_ATI_element_array = GL_FALSE;
-GLboolean __GLEW_ATI_envmap_bumpmap = GL_FALSE;
-GLboolean __GLEW_ATI_fragment_shader = GL_FALSE;
-GLboolean __GLEW_ATI_map_object_buffer = GL_FALSE;
-GLboolean __GLEW_ATI_pn_triangles = GL_FALSE;
-GLboolean __GLEW_ATI_separate_stencil = GL_FALSE;
-GLboolean __GLEW_ATI_text_fragment_shader = GL_FALSE;
-GLboolean __GLEW_ATI_texture_compression_3dc = GL_FALSE;
-GLboolean __GLEW_ATI_texture_env_combine3 = GL_FALSE;
-GLboolean __GLEW_ATI_texture_float = GL_FALSE;
-GLboolean __GLEW_ATI_texture_mirror_once = GL_FALSE;
-GLboolean __GLEW_ATI_vertex_array_object = GL_FALSE;
-GLboolean __GLEW_ATI_vertex_attrib_array_object = GL_FALSE;
-GLboolean __GLEW_ATI_vertex_streams = GL_FALSE;
-GLboolean __GLEW_EXT_422_pixels = GL_FALSE;
-GLboolean __GLEW_EXT_Cg_shader = GL_FALSE;
-GLboolean __GLEW_EXT_abgr = GL_FALSE;
-GLboolean __GLEW_EXT_bgra = GL_FALSE;
-GLboolean __GLEW_EXT_blend_color = GL_FALSE;
-GLboolean __GLEW_EXT_blend_equation_separate = GL_FALSE;
-GLboolean __GLEW_EXT_blend_func_separate = GL_FALSE;
-GLboolean __GLEW_EXT_blend_logic_op = GL_FALSE;
-GLboolean __GLEW_EXT_blend_minmax = GL_FALSE;
-GLboolean __GLEW_EXT_blend_subtract = GL_FALSE;
-GLboolean __GLEW_EXT_clip_volume_hint = GL_FALSE;
-GLboolean __GLEW_EXT_cmyka = GL_FALSE;
-GLboolean __GLEW_EXT_color_subtable = GL_FALSE;
-GLboolean __GLEW_EXT_compiled_vertex_array = GL_FALSE;
-GLboolean __GLEW_EXT_convolution = GL_FALSE;
-GLboolean __GLEW_EXT_coordinate_frame = GL_FALSE;
-GLboolean __GLEW_EXT_copy_texture = GL_FALSE;
-GLboolean __GLEW_EXT_cull_vertex = GL_FALSE;
-GLboolean __GLEW_EXT_depth_bounds_test = GL_FALSE;
-GLboolean __GLEW_EXT_draw_range_elements = GL_FALSE;
-GLboolean __GLEW_EXT_fog_coord = GL_FALSE;
-GLboolean __GLEW_EXT_fragment_lighting = GL_FALSE;
-GLboolean __GLEW_EXT_framebuffer_blit = GL_FALSE;
-GLboolean __GLEW_EXT_framebuffer_multisample = GL_FALSE;
-GLboolean __GLEW_EXT_framebuffer_object = GL_FALSE;
-GLboolean __GLEW_EXT_histogram = GL_FALSE;
-GLboolean __GLEW_EXT_index_array_formats = GL_FALSE;
-GLboolean __GLEW_EXT_index_func = GL_FALSE;
-GLboolean __GLEW_EXT_index_material = GL_FALSE;
-GLboolean __GLEW_EXT_index_texture = GL_FALSE;
-GLboolean __GLEW_EXT_light_texture = GL_FALSE;
-GLboolean __GLEW_EXT_misc_attribute = GL_FALSE;
-GLboolean __GLEW_EXT_multi_draw_arrays = GL_FALSE;
-GLboolean __GLEW_EXT_multisample = GL_FALSE;
-GLboolean __GLEW_EXT_packed_depth_stencil = GL_FALSE;
-GLboolean __GLEW_EXT_packed_pixels = GL_FALSE;
-GLboolean __GLEW_EXT_paletted_texture = GL_FALSE;
-GLboolean __GLEW_EXT_pixel_buffer_object = GL_FALSE;
-GLboolean __GLEW_EXT_pixel_transform = GL_FALSE;
-GLboolean __GLEW_EXT_pixel_transform_color_table = GL_FALSE;
-GLboolean __GLEW_EXT_point_parameters = GL_FALSE;
-GLboolean __GLEW_EXT_polygon_offset = GL_FALSE;
-GLboolean __GLEW_EXT_rescale_normal = GL_FALSE;
-GLboolean __GLEW_EXT_scene_marker = GL_FALSE;
-GLboolean __GLEW_EXT_secondary_color = GL_FALSE;
-GLboolean __GLEW_EXT_separate_specular_color = GL_FALSE;
-GLboolean __GLEW_EXT_shadow_funcs = GL_FALSE;
-GLboolean __GLEW_EXT_shared_texture_palette = GL_FALSE;
-GLboolean __GLEW_EXT_stencil_clear_tag = GL_FALSE;
-GLboolean __GLEW_EXT_stencil_two_side = GL_FALSE;
-GLboolean __GLEW_EXT_stencil_wrap = GL_FALSE;
-GLboolean __GLEW_EXT_subtexture = GL_FALSE;
-GLboolean __GLEW_EXT_texture = GL_FALSE;
-GLboolean __GLEW_EXT_texture3D = GL_FALSE;
-GLboolean __GLEW_EXT_texture_compression_dxt1 = GL_FALSE;
-GLboolean __GLEW_EXT_texture_compression_s3tc = GL_FALSE;
-GLboolean __GLEW_EXT_texture_cube_map = GL_FALSE;
-GLboolean __GLEW_EXT_texture_edge_clamp = GL_FALSE;
-GLboolean __GLEW_EXT_texture_env = GL_FALSE;
-GLboolean __GLEW_EXT_texture_env_add = GL_FALSE;
-GLboolean __GLEW_EXT_texture_env_combine = GL_FALSE;
-GLboolean __GLEW_EXT_texture_env_dot3 = GL_FALSE;
-GLboolean __GLEW_EXT_texture_filter_anisotropic = GL_FALSE;
-GLboolean __GLEW_EXT_texture_lod_bias = GL_FALSE;
-GLboolean __GLEW_EXT_texture_mirror_clamp = GL_FALSE;
-GLboolean __GLEW_EXT_texture_object = GL_FALSE;
-GLboolean __GLEW_EXT_texture_perturb_normal = GL_FALSE;
-GLboolean __GLEW_EXT_texture_rectangle = GL_FALSE;
-GLboolean __GLEW_EXT_texture_sRGB = GL_FALSE;
-GLboolean __GLEW_EXT_vertex_array = GL_FALSE;
-GLboolean __GLEW_EXT_vertex_shader = GL_FALSE;
-GLboolean __GLEW_EXT_vertex_weighting = GL_FALSE;
-GLboolean __GLEW_GREMEDY_string_marker = GL_FALSE;
-GLboolean __GLEW_HP_convolution_border_modes = GL_FALSE;
-GLboolean __GLEW_HP_image_transform = GL_FALSE;
-GLboolean __GLEW_HP_occlusion_test = GL_FALSE;
-GLboolean __GLEW_HP_texture_lighting = GL_FALSE;
-GLboolean __GLEW_IBM_cull_vertex = GL_FALSE;
-GLboolean __GLEW_IBM_multimode_draw_arrays = GL_FALSE;
-GLboolean __GLEW_IBM_rasterpos_clip = GL_FALSE;
-GLboolean __GLEW_IBM_static_data = GL_FALSE;
-GLboolean __GLEW_IBM_texture_mirrored_repeat = GL_FALSE;
-GLboolean __GLEW_IBM_vertex_array_lists = GL_FALSE;
-GLboolean __GLEW_INGR_color_clamp = GL_FALSE;
-GLboolean __GLEW_INGR_interlace_read = GL_FALSE;
-GLboolean __GLEW_INTEL_parallel_arrays = GL_FALSE;
-GLboolean __GLEW_INTEL_texture_scissor = GL_FALSE;
-GLboolean __GLEW_KTX_buffer_region = GL_FALSE;
-GLboolean __GLEW_MESAX_texture_stack = GL_FALSE;
-GLboolean __GLEW_MESA_pack_invert = GL_FALSE;
-GLboolean __GLEW_MESA_resize_buffers = GL_FALSE;
-GLboolean __GLEW_MESA_window_pos = GL_FALSE;
-GLboolean __GLEW_MESA_ycbcr_texture = GL_FALSE;
-GLboolean __GLEW_NV_blend_square = GL_FALSE;
-GLboolean __GLEW_NV_copy_depth_to_color = GL_FALSE;
-GLboolean __GLEW_NV_depth_clamp = GL_FALSE;
-GLboolean __GLEW_NV_evaluators = GL_FALSE;
-GLboolean __GLEW_NV_fence = GL_FALSE;
-GLboolean __GLEW_NV_float_buffer = GL_FALSE;
-GLboolean __GLEW_NV_fog_distance = GL_FALSE;
-GLboolean __GLEW_NV_fragment_program = GL_FALSE;
-GLboolean __GLEW_NV_fragment_program2 = GL_FALSE;
-GLboolean __GLEW_NV_fragment_program_option = GL_FALSE;
-GLboolean __GLEW_NV_half_float = GL_FALSE;
-GLboolean __GLEW_NV_light_max_exponent = GL_FALSE;
-GLboolean __GLEW_NV_multisample_filter_hint = GL_FALSE;
-GLboolean __GLEW_NV_occlusion_query = GL_FALSE;
-GLboolean __GLEW_NV_packed_depth_stencil = GL_FALSE;
-GLboolean __GLEW_NV_pixel_data_range = GL_FALSE;
-GLboolean __GLEW_NV_point_sprite = GL_FALSE;
-GLboolean __GLEW_NV_primitive_restart = GL_FALSE;
-GLboolean __GLEW_NV_register_combiners = GL_FALSE;
-GLboolean __GLEW_NV_register_combiners2 = GL_FALSE;
-GLboolean __GLEW_NV_texgen_emboss = GL_FALSE;
-GLboolean __GLEW_NV_texgen_reflection = GL_FALSE;
-GLboolean __GLEW_NV_texture_compression_vtc = GL_FALSE;
-GLboolean __GLEW_NV_texture_env_combine4 = GL_FALSE;
-GLboolean __GLEW_NV_texture_expand_normal = GL_FALSE;
-GLboolean __GLEW_NV_texture_rectangle = GL_FALSE;
-GLboolean __GLEW_NV_texture_shader = GL_FALSE;
-GLboolean __GLEW_NV_texture_shader2 = GL_FALSE;
-GLboolean __GLEW_NV_texture_shader3 = GL_FALSE;
-GLboolean __GLEW_NV_vertex_array_range = GL_FALSE;
-GLboolean __GLEW_NV_vertex_array_range2 = GL_FALSE;
-GLboolean __GLEW_NV_vertex_program = GL_FALSE;
-GLboolean __GLEW_NV_vertex_program1_1 = GL_FALSE;
-GLboolean __GLEW_NV_vertex_program2 = GL_FALSE;
-GLboolean __GLEW_NV_vertex_program2_option = GL_FALSE;
-GLboolean __GLEW_NV_vertex_program3 = GL_FALSE;
-GLboolean __GLEW_OML_interlace = GL_FALSE;
-GLboolean __GLEW_OML_resample = GL_FALSE;
-GLboolean __GLEW_OML_subsample = GL_FALSE;
-GLboolean __GLEW_PGI_misc_hints = GL_FALSE;
-GLboolean __GLEW_PGI_vertex_hints = GL_FALSE;
-GLboolean __GLEW_REND_screen_coordinates = GL_FALSE;
-GLboolean __GLEW_S3_s3tc = GL_FALSE;
-GLboolean __GLEW_SGIS_color_range = GL_FALSE;
-GLboolean __GLEW_SGIS_detail_texture = GL_FALSE;
-GLboolean __GLEW_SGIS_fog_function = GL_FALSE;
-GLboolean __GLEW_SGIS_generate_mipmap = GL_FALSE;
-GLboolean __GLEW_SGIS_multisample = GL_FALSE;
-GLboolean __GLEW_SGIS_pixel_texture = GL_FALSE;
-GLboolean __GLEW_SGIS_sharpen_texture = GL_FALSE;
-GLboolean __GLEW_SGIS_texture4D = GL_FALSE;
-GLboolean __GLEW_SGIS_texture_border_clamp = GL_FALSE;
-GLboolean __GLEW_SGIS_texture_edge_clamp = GL_FALSE;
-GLboolean __GLEW_SGIS_texture_filter4 = GL_FALSE;
-GLboolean __GLEW_SGIS_texture_lod = GL_FALSE;
-GLboolean __GLEW_SGIS_texture_select = GL_FALSE;
-GLboolean __GLEW_SGIX_async = GL_FALSE;
-GLboolean __GLEW_SGIX_async_histogram = GL_FALSE;
-GLboolean __GLEW_SGIX_async_pixel = GL_FALSE;
-GLboolean __GLEW_SGIX_blend_alpha_minmax = GL_FALSE;
-GLboolean __GLEW_SGIX_clipmap = GL_FALSE;
-GLboolean __GLEW_SGIX_depth_texture = GL_FALSE;
-GLboolean __GLEW_SGIX_flush_raster = GL_FALSE;
-GLboolean __GLEW_SGIX_fog_offset = GL_FALSE;
-GLboolean __GLEW_SGIX_fog_texture = GL_FALSE;
-GLboolean __GLEW_SGIX_fragment_specular_lighting = GL_FALSE;
-GLboolean __GLEW_SGIX_framezoom = GL_FALSE;
-GLboolean __GLEW_SGIX_interlace = GL_FALSE;
-GLboolean __GLEW_SGIX_ir_instrument1 = GL_FALSE;
-GLboolean __GLEW_SGIX_list_priority = GL_FALSE;
-GLboolean __GLEW_SGIX_pixel_texture = GL_FALSE;
-GLboolean __GLEW_SGIX_pixel_texture_bits = GL_FALSE;
-GLboolean __GLEW_SGIX_reference_plane = GL_FALSE;
-GLboolean __GLEW_SGIX_resample = GL_FALSE;
-GLboolean __GLEW_SGIX_shadow = GL_FALSE;
-GLboolean __GLEW_SGIX_shadow_ambient = GL_FALSE;
-GLboolean __GLEW_SGIX_sprite = GL_FALSE;
-GLboolean __GLEW_SGIX_tag_sample_buffer = GL_FALSE;
-GLboolean __GLEW_SGIX_texture_add_env = GL_FALSE;
-GLboolean __GLEW_SGIX_texture_coordinate_clamp = GL_FALSE;
-GLboolean __GLEW_SGIX_texture_lod_bias = GL_FALSE;
-GLboolean __GLEW_SGIX_texture_multi_buffer = GL_FALSE;
-GLboolean __GLEW_SGIX_texture_range = GL_FALSE;
-GLboolean __GLEW_SGIX_texture_scale_bias = GL_FALSE;
-GLboolean __GLEW_SGIX_vertex_preclip = GL_FALSE;
-GLboolean __GLEW_SGIX_vertex_preclip_hint = GL_FALSE;
-GLboolean __GLEW_SGIX_ycrcb = GL_FALSE;
-GLboolean __GLEW_SGI_color_matrix = GL_FALSE;
-GLboolean __GLEW_SGI_color_table = GL_FALSE;
-GLboolean __GLEW_SGI_texture_color_table = GL_FALSE;
-GLboolean __GLEW_SUNX_constant_data = GL_FALSE;
-GLboolean __GLEW_SUN_convolution_border_modes = GL_FALSE;
-GLboolean __GLEW_SUN_global_alpha = GL_FALSE;
-GLboolean __GLEW_SUN_mesh_array = GL_FALSE;
-GLboolean __GLEW_SUN_read_video_pixels = GL_FALSE;
-GLboolean __GLEW_SUN_slice_accum = GL_FALSE;
-GLboolean __GLEW_SUN_triangle_list = GL_FALSE;
-GLboolean __GLEW_SUN_vertex = GL_FALSE;
-GLboolean __GLEW_WIN_phong_shading = GL_FALSE;
-GLboolean __GLEW_WIN_specular_fog = GL_FALSE;
-GLboolean __GLEW_WIN_swap_hint = GL_FALSE;
-#endif /* !GLEW_MX */
-#ifdef GL_VERSION_1_2
-static GLboolean _glewInit_GL_VERSION_1_2 (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glCopyTexSubImage3D = (PFNGLCOPYTEXSUBIMAGE3DPROC)glewGetProcAddress((const GLubyte*)"glCopyTexSubImage3D")) == NULL) || r;
-  r = ((glDrawRangeElements = (PFNGLDRAWRANGEELEMENTSPROC)glewGetProcAddress((const GLubyte*)"glDrawRangeElements")) == NULL) || r;
-  r = ((glTexImage3D = (PFNGLTEXIMAGE3DPROC)glewGetProcAddress((const GLubyte*)"glTexImage3D")) == NULL) || r;
-  r = ((glTexSubImage3D = (PFNGLTEXSUBIMAGE3DPROC)glewGetProcAddress((const GLubyte*)"glTexSubImage3D")) == NULL) || r;
-  return r;
-#endif /* GL_VERSION_1_2 */
-#ifdef GL_VERSION_1_3
-static GLboolean _glewInit_GL_VERSION_1_3 (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glActiveTexture = (PFNGLACTIVETEXTUREPROC)glewGetProcAddress((const GLubyte*)"glActiveTexture")) == NULL) || r;
-  r = ((glClientActiveTexture = (PFNGLCLIENTACTIVETEXTUREPROC)glewGetProcAddress((const GLubyte*)"glClientActiveTexture")) == NULL) || r;
-  r = ((glCompressedTexImage1D = (PFNGLCOMPRESSEDTEXIMAGE1DPROC)glewGetProcAddress((const GLubyte*)"glCompressedTexImage1D")) == NULL) || r;
-  r = ((glCompressedTexImage2D = (PFNGLCOMPRESSEDTEXIMAGE2DPROC)glewGetProcAddress((const GLubyte*)"glCompressedTexImage2D")) == NULL) || r;
-  r = ((glCompressedTexImage3D = (PFNGLCOMPRESSEDTEXIMAGE3DPROC)glewGetProcAddress((const GLubyte*)"glCompressedTexImage3D")) == NULL) || r;
-  r = ((glCompressedTexSubImage1D = (PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC)glewGetProcAddress((const GLubyte*)"glCompressedTexSubImage1D")) == NULL) || r;
-  r = ((glCompressedTexSubImage2D = (PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC)glewGetProcAddress((const GLubyte*)"glCompressedTexSubImage2D")) == NULL) || r;
-  r = ((glCompressedTexSubImage3D = (PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC)glewGetProcAddress((const GLubyte*)"glCompressedTexSubImage3D")) == NULL) || r;
-  r = ((glGetCompressedTexImage = (PFNGLGETCOMPRESSEDTEXIMAGEPROC)glewGetProcAddress((const GLubyte*)"glGetCompressedTexImage")) == NULL) || r;
-  r = ((glLoadTransposeMatrixd = (PFNGLLOADTRANSPOSEMATRIXDPROC)glewGetProcAddress((const GLubyte*)"glLoadTransposeMatrixd")) == NULL) || r;
-  r = ((glLoadTransposeMatrixf = (PFNGLLOADTRANSPOSEMATRIXFPROC)glewGetProcAddress((const GLubyte*)"glLoadTransposeMatrixf")) == NULL) || r;
-  r = ((glMultTransposeMatrixd = (PFNGLMULTTRANSPOSEMATRIXDPROC)glewGetProcAddress((const GLubyte*)"glMultTransposeMatrixd")) == NULL) || r;
-  r = ((glMultTransposeMatrixf = (PFNGLMULTTRANSPOSEMATRIXFPROC)glewGetProcAddress((const GLubyte*)"glMultTransposeMatrixf")) == NULL) || r;
-  r = ((glMultiTexCoord1d = (PFNGLMULTITEXCOORD1DPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1d")) == NULL) || r;
-  r = ((glMultiTexCoord1dv = (PFNGLMULTITEXCOORD1DVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1dv")) == NULL) || r;
-  r = ((glMultiTexCoord1f = (PFNGLMULTITEXCOORD1FPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1f")) == NULL) || r;
-  r = ((glMultiTexCoord1fv = (PFNGLMULTITEXCOORD1FVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1fv")) == NULL) || r;
-  r = ((glMultiTexCoord1i = (PFNGLMULTITEXCOORD1IPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1i")) == NULL) || r;
-  r = ((glMultiTexCoord1iv = (PFNGLMULTITEXCOORD1IVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1iv")) == NULL) || r;
-  r = ((glMultiTexCoord1s = (PFNGLMULTITEXCOORD1SPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1s")) == NULL) || r;
-  r = ((glMultiTexCoord1sv = (PFNGLMULTITEXCOORD1SVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1sv")) == NULL) || r;
-  r = ((glMultiTexCoord2d = (PFNGLMULTITEXCOORD2DPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2d")) == NULL) || r;
-  r = ((glMultiTexCoord2dv = (PFNGLMULTITEXCOORD2DVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2dv")) == NULL) || r;
-  r = ((glMultiTexCoord2f = (PFNGLMULTITEXCOORD2FPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2f")) == NULL) || r;
-  r = ((glMultiTexCoord2fv = (PFNGLMULTITEXCOORD2FVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2fv")) == NULL) || r;
-  r = ((glMultiTexCoord2i = (PFNGLMULTITEXCOORD2IPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2i")) == NULL) || r;
-  r = ((glMultiTexCoord2iv = (PFNGLMULTITEXCOORD2IVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2iv")) == NULL) || r;
-  r = ((glMultiTexCoord2s = (PFNGLMULTITEXCOORD2SPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2s")) == NULL) || r;
-  r = ((glMultiTexCoord2sv = (PFNGLMULTITEXCOORD2SVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2sv")) == NULL) || r;
-  r = ((glMultiTexCoord3d = (PFNGLMULTITEXCOORD3DPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3d")) == NULL) || r;
-  r = ((glMultiTexCoord3dv = (PFNGLMULTITEXCOORD3DVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3dv")) == NULL) || r;
-  r = ((glMultiTexCoord3f = (PFNGLMULTITEXCOORD3FPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3f")) == NULL) || r;
-  r = ((glMultiTexCoord3fv = (PFNGLMULTITEXCOORD3FVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3fv")) == NULL) || r;
-  r = ((glMultiTexCoord3i = (PFNGLMULTITEXCOORD3IPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3i")) == NULL) || r;
-  r = ((glMultiTexCoord3iv = (PFNGLMULTITEXCOORD3IVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3iv")) == NULL) || r;
-  r = ((glMultiTexCoord3s = (PFNGLMULTITEXCOORD3SPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3s")) == NULL) || r;
-  r = ((glMultiTexCoord3sv = (PFNGLMULTITEXCOORD3SVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3sv")) == NULL) || r;
-  r = ((glMultiTexCoord4d = (PFNGLMULTITEXCOORD4DPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4d")) == NULL) || r;
-  r = ((glMultiTexCoord4dv = (PFNGLMULTITEXCOORD4DVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4dv")) == NULL) || r;
-  r = ((glMultiTexCoord4f = (PFNGLMULTITEXCOORD4FPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4f")) == NULL) || r;
-  r = ((glMultiTexCoord4fv = (PFNGLMULTITEXCOORD4FVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4fv")) == NULL) || r;
-  r = ((glMultiTexCoord4i = (PFNGLMULTITEXCOORD4IPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4i")) == NULL) || r;
-  r = ((glMultiTexCoord4iv = (PFNGLMULTITEXCOORD4IVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4iv")) == NULL) || r;
-  r = ((glMultiTexCoord4s = (PFNGLMULTITEXCOORD4SPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4s")) == NULL) || r;
-  r = ((glMultiTexCoord4sv = (PFNGLMULTITEXCOORD4SVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4sv")) == NULL) || r;
-  r = ((glSampleCoverage = (PFNGLSAMPLECOVERAGEPROC)glewGetProcAddress((const GLubyte*)"glSampleCoverage")) == NULL) || r;
-  return r;
-#endif /* GL_VERSION_1_3 */
-#ifdef GL_VERSION_1_4
-static GLboolean _glewInit_GL_VERSION_1_4 (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBlendColor = (PFNGLBLENDCOLORPROC)glewGetProcAddress((const GLubyte*)"glBlendColor")) == NULL) || r;
-  r = ((glBlendEquation = (PFNGLBLENDEQUATIONPROC)glewGetProcAddress((const GLubyte*)"glBlendEquation")) == NULL) || r;
-  r = ((glBlendFuncSeparate = (PFNGLBLENDFUNCSEPARATEPROC)glewGetProcAddress((const GLubyte*)"glBlendFuncSeparate")) == NULL) || r;
-  r = ((glFogCoordPointer = (PFNGLFOGCOORDPOINTERPROC)glewGetProcAddress((const GLubyte*)"glFogCoordPointer")) == NULL) || r;
-  r = ((glFogCoordd = (PFNGLFOGCOORDDPROC)glewGetProcAddress((const GLubyte*)"glFogCoordd")) == NULL) || r;
-  r = ((glFogCoorddv = (PFNGLFOGCOORDDVPROC)glewGetProcAddress((const GLubyte*)"glFogCoorddv")) == NULL) || r;
-  r = ((glFogCoordf = (PFNGLFOGCOORDFPROC)glewGetProcAddress((const GLubyte*)"glFogCoordf")) == NULL) || r;
-  r = ((glFogCoordfv = (PFNGLFOGCOORDFVPROC)glewGetProcAddress((const GLubyte*)"glFogCoordfv")) == NULL) || r;
-  r = ((glMultiDrawArrays = (PFNGLMULTIDRAWARRAYSPROC)glewGetProcAddress((const GLubyte*)"glMultiDrawArrays")) == NULL) || r;
-  r = ((glMultiDrawElements = (PFNGLMULTIDRAWELEMENTSPROC)glewGetProcAddress((const GLubyte*)"glMultiDrawElements")) == NULL) || r;
-  r = ((glPointParameterf = (PFNGLPOINTPARAMETERFPROC)glewGetProcAddress((const GLubyte*)"glPointParameterf")) == NULL) || r;
-  r = ((glPointParameterfv = (PFNGLPOINTPARAMETERFVPROC)glewGetProcAddress((const GLubyte*)"glPointParameterfv")) == NULL) || r;
-  r = ((glSecondaryColor3b = (PFNGLSECONDARYCOLOR3BPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3b")) == NULL) || r;
-  r = ((glSecondaryColor3bv = (PFNGLSECONDARYCOLOR3BVPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3bv")) == NULL) || r;
-  r = ((glSecondaryColor3d = (PFNGLSECONDARYCOLOR3DPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3d")) == NULL) || r;
-  r = ((glSecondaryColor3dv = (PFNGLSECONDARYCOLOR3DVPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3dv")) == NULL) || r;
-  r = ((glSecondaryColor3f = (PFNGLSECONDARYCOLOR3FPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3f")) == NULL) || r;
-  r = ((glSecondaryColor3fv = (PFNGLSECONDARYCOLOR3FVPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3fv")) == NULL) || r;
-  r = ((glSecondaryColor3i = (PFNGLSECONDARYCOLOR3IPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3i")) == NULL) || r;
-  r = ((glSecondaryColor3iv = (PFNGLSECONDARYCOLOR3IVPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3iv")) == NULL) || r;
-  r = ((glSecondaryColor3s = (PFNGLSECONDARYCOLOR3SPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3s")) == NULL) || r;
-  r = ((glSecondaryColor3sv = (PFNGLSECONDARYCOLOR3SVPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3sv")) == NULL) || r;
-  r = ((glSecondaryColor3ub = (PFNGLSECONDARYCOLOR3UBPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3ub")) == NULL) || r;
-  r = ((glSecondaryColor3ubv = (PFNGLSECONDARYCOLOR3UBVPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3ubv")) == NULL) || r;
-  r = ((glSecondaryColor3ui = (PFNGLSECONDARYCOLOR3UIPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3ui")) == NULL) || r;
-  r = ((glSecondaryColor3uiv = (PFNGLSECONDARYCOLOR3UIVPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3uiv")) == NULL) || r;
-  r = ((glSecondaryColor3us = (PFNGLSECONDARYCOLOR3USPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3us")) == NULL) || r;
-  r = ((glSecondaryColor3usv = (PFNGLSECONDARYCOLOR3USVPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3usv")) == NULL) || r;
-  r = ((glSecondaryColorPointer = (PFNGLSECONDARYCOLORPOINTERPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColorPointer")) == NULL) || r;
-  r = ((glWindowPos2d = (PFNGLWINDOWPOS2DPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2d")) == NULL) || r;
-  r = ((glWindowPos2dv = (PFNGLWINDOWPOS2DVPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2dv")) == NULL) || r;
-  r = ((glWindowPos2f = (PFNGLWINDOWPOS2FPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2f")) == NULL) || r;
-  r = ((glWindowPos2fv = (PFNGLWINDOWPOS2FVPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2fv")) == NULL) || r;
-  r = ((glWindowPos2i = (PFNGLWINDOWPOS2IPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2i")) == NULL) || r;
-  r = ((glWindowPos2iv = (PFNGLWINDOWPOS2IVPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2iv")) == NULL) || r;
-  r = ((glWindowPos2s = (PFNGLWINDOWPOS2SPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2s")) == NULL) || r;
-  r = ((glWindowPos2sv = (PFNGLWINDOWPOS2SVPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2sv")) == NULL) || r;
-  r = ((glWindowPos3d = (PFNGLWINDOWPOS3DPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3d")) == NULL) || r;
-  r = ((glWindowPos3dv = (PFNGLWINDOWPOS3DVPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3dv")) == NULL) || r;
-  r = ((glWindowPos3f = (PFNGLWINDOWPOS3FPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3f")) == NULL) || r;
-  r = ((glWindowPos3fv = (PFNGLWINDOWPOS3FVPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3fv")) == NULL) || r;
-  r = ((glWindowPos3i = (PFNGLWINDOWPOS3IPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3i")) == NULL) || r;
-  r = ((glWindowPos3iv = (PFNGLWINDOWPOS3IVPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3iv")) == NULL) || r;
-  r = ((glWindowPos3s = (PFNGLWINDOWPOS3SPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3s")) == NULL) || r;
-  r = ((glWindowPos3sv = (PFNGLWINDOWPOS3SVPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3sv")) == NULL) || r;
-  return r;
-#endif /* GL_VERSION_1_4 */
-#ifdef GL_VERSION_1_5
-static GLboolean _glewInit_GL_VERSION_1_5 (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBeginQuery = (PFNGLBEGINQUERYPROC)glewGetProcAddress((const GLubyte*)"glBeginQuery")) == NULL) || r;
-  r = ((glBindBuffer = (PFNGLBINDBUFFERPROC)glewGetProcAddress((const GLubyte*)"glBindBuffer")) == NULL) || r;
-  r = ((glBufferData = (PFNGLBUFFERDATAPROC)glewGetProcAddress((const GLubyte*)"glBufferData")) == NULL) || r;
-  r = ((glBufferSubData = (PFNGLBUFFERSUBDATAPROC)glewGetProcAddress((const GLubyte*)"glBufferSubData")) == NULL) || r;
-  r = ((glDeleteBuffers = (PFNGLDELETEBUFFERSPROC)glewGetProcAddress((const GLubyte*)"glDeleteBuffers")) == NULL) || r;
-  r = ((glDeleteQueries = (PFNGLDELETEQUERIESPROC)glewGetProcAddress((const GLubyte*)"glDeleteQueries")) == NULL) || r;
-  r = ((glEndQuery = (PFNGLENDQUERYPROC)glewGetProcAddress((const GLubyte*)"glEndQuery")) == NULL) || r;
-  r = ((glGenBuffers = (PFNGLGENBUFFERSPROC)glewGetProcAddress((const GLubyte*)"glGenBuffers")) == NULL) || r;
-  r = ((glGenQueries = (PFNGLGENQUERIESPROC)glewGetProcAddress((const GLubyte*)"glGenQueries")) == NULL) || r;
-  r = ((glGetBufferParameteriv = (PFNGLGETBUFFERPARAMETERIVPROC)glewGetProcAddress((const GLubyte*)"glGetBufferParameteriv")) == NULL) || r;
-  r = ((glGetBufferPointerv = (PFNGLGETBUFFERPOINTERVPROC)glewGetProcAddress((const GLubyte*)"glGetBufferPointerv")) == NULL) || r;
-  r = ((glGetBufferSubData = (PFNGLGETBUFFERSUBDATAPROC)glewGetProcAddress((const GLubyte*)"glGetBufferSubData")) == NULL) || r;
-  r = ((glGetQueryObjectiv = (PFNGLGETQUERYOBJECTIVPROC)glewGetProcAddress((const GLubyte*)"glGetQueryObjectiv")) == NULL) || r;
-  r = ((glGetQueryObjectuiv = (PFNGLGETQUERYOBJECTUIVPROC)glewGetProcAddress((const GLubyte*)"glGetQueryObjectuiv")) == NULL) || r;
-  r = ((glGetQueryiv = (PFNGLGETQUERYIVPROC)glewGetProcAddress((const GLubyte*)"glGetQueryiv")) == NULL) || r;
-  r = ((glIsBuffer = (PFNGLISBUFFERPROC)glewGetProcAddress((const GLubyte*)"glIsBuffer")) == NULL) || r;
-  r = ((glIsQuery = (PFNGLISQUERYPROC)glewGetProcAddress((const GLubyte*)"glIsQuery")) == NULL) || r;
-  r = ((glMapBuffer = (PFNGLMAPBUFFERPROC)glewGetProcAddress((const GLubyte*)"glMapBuffer")) == NULL) || r;
-  r = ((glUnmapBuffer = (PFNGLUNMAPBUFFERPROC)glewGetProcAddress((const GLubyte*)"glUnmapBuffer")) == NULL) || r;
-  return r;
-#endif /* GL_VERSION_1_5 */
-#ifdef GL_VERSION_2_0
-static GLboolean _glewInit_GL_VERSION_2_0 (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glAttachShader = (PFNGLATTACHSHADERPROC)glewGetProcAddress((const GLubyte*)"glAttachShader")) == NULL) || r;
-  r = ((glBindAttribLocation = (PFNGLBINDATTRIBLOCATIONPROC)glewGetProcAddress((const GLubyte*)"glBindAttribLocation")) == NULL) || r;
-  r = ((glBlendEquationSeparate = (PFNGLBLENDEQUATIONSEPARATEPROC)glewGetProcAddress((const GLubyte*)"glBlendEquationSeparate")) == NULL) || r;
-  r = ((glCompileShader = (PFNGLCOMPILESHADERPROC)glewGetProcAddress((const GLubyte*)"glCompileShader")) == NULL) || r;
-  r = ((glCreateProgram = (PFNGLCREATEPROGRAMPROC)glewGetProcAddress((const GLubyte*)"glCreateProgram")) == NULL) || r;
-  r = ((glCreateShader = (PFNGLCREATESHADERPROC)glewGetProcAddress((const GLubyte*)"glCreateShader")) == NULL) || r;
-  r = ((glDeleteProgram = (PFNGLDELETEPROGRAMPROC)glewGetProcAddress((const GLubyte*)"glDeleteProgram")) == NULL) || r;
-  r = ((glDeleteShader = (PFNGLDELETESHADERPROC)glewGetProcAddress((const GLubyte*)"glDeleteShader")) == NULL) || r;
-  r = ((glDetachShader = (PFNGLDETACHSHADERPROC)glewGetProcAddress((const GLubyte*)"glDetachShader")) == NULL) || r;
-  r = ((glDisableVertexAttribArray = (PFNGLDISABLEVERTEXATTRIBARRAYPROC)glewGetProcAddress((const GLubyte*)"glDisableVertexAttribArray")) == NULL) || r;
-  r = ((glDrawBuffers = (PFNGLDRAWBUFFERSPROC)glewGetProcAddress((const GLubyte*)"glDrawBuffers")) == NULL) || r;
-  r = ((glEnableVertexAttribArray = (PFNGLENABLEVERTEXATTRIBARRAYPROC)glewGetProcAddress((const GLubyte*)"glEnableVertexAttribArray")) == NULL) || r;
-  r = ((glGetActiveAttrib = (PFNGLGETACTIVEATTRIBPROC)glewGetProcAddress((const GLubyte*)"glGetActiveAttrib")) == NULL) || r;
-  r = ((glGetActiveUniform = (PFNGLGETACTIVEUNIFORMPROC)glewGetProcAddress((const GLubyte*)"glGetActiveUniform")) == NULL) || r;
-  r = ((glGetAttachedShaders = (PFNGLGETATTACHEDSHADERSPROC)glewGetProcAddress((const GLubyte*)"glGetAttachedShaders")) == NULL) || r;
-  r = ((glGetAttribLocation = (PFNGLGETATTRIBLOCATIONPROC)glewGetProcAddress((const GLubyte*)"glGetAttribLocation")) == NULL) || r;
-  r = ((glGetProgramInfoLog = (PFNGLGETPROGRAMINFOLOGPROC)glewGetProcAddress((const GLubyte*)"glGetProgramInfoLog")) == NULL) || r;
-  r = ((glGetProgramiv = (PFNGLGETPROGRAMIVPROC)glewGetProcAddress((const GLubyte*)"glGetProgramiv")) == NULL) || r;
-  r = ((glGetShaderInfoLog = (PFNGLGETSHADERINFOLOGPROC)glewGetProcAddress((const GLubyte*)"glGetShaderInfoLog")) == NULL) || r;
-  r = ((glGetShaderSource = (PFNGLGETSHADERSOURCEPROC)glewGetProcAddress((const GLubyte*)"glGetShaderSource")) == NULL) || r;
-  r = ((glGetShaderiv = (PFNGLGETSHADERIVPROC)glewGetProcAddress((const GLubyte*)"glGetShaderiv")) == NULL) || r;
-  r = ((glGetUniformLocation = (PFNGLGETUNIFORMLOCATIONPROC)glewGetProcAddress((const GLubyte*)"glGetUniformLocation")) == NULL) || r;
-  r = ((glGetUniformfv = (PFNGLGETUNIFORMFVPROC)glewGetProcAddress((const GLubyte*)"glGetUniformfv")) == NULL) || r;
-  r = ((glGetUniformiv = (PFNGLGETUNIFORMIVPROC)glewGetProcAddress((const GLubyte*)"glGetUniformiv")) == NULL) || r;
-  r = ((glGetVertexAttribPointerv = (PFNGLGETVERTEXATTRIBPOINTERVPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribPointerv")) == NULL) || r;
-  r = ((glGetVertexAttribdv = (PFNGLGETVERTEXATTRIBDVPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribdv")) == NULL) || r;
-  r = ((glGetVertexAttribfv = (PFNGLGETVERTEXATTRIBFVPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribfv")) == NULL) || r;
-  r = ((glGetVertexAttribiv = (PFNGLGETVERTEXATTRIBIVPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribiv")) == NULL) || r;
-  r = ((glIsProgram = (PFNGLISPROGRAMPROC)glewGetProcAddress((const GLubyte*)"glIsProgram")) == NULL) || r;
-  r = ((glIsShader = (PFNGLISSHADERPROC)glewGetProcAddress((const GLubyte*)"glIsShader")) == NULL) || r;
-  r = ((glLinkProgram = (PFNGLLINKPROGRAMPROC)glewGetProcAddress((const GLubyte*)"glLinkProgram")) == NULL) || r;
-  r = ((glShaderSource = (PFNGLSHADERSOURCEPROC)glewGetProcAddress((const GLubyte*)"glShaderSource")) == NULL) || r;
-  r = ((glStencilFuncSeparate = (PFNGLSTENCILFUNCSEPARATEPROC)glewGetProcAddress((const GLubyte*)"glStencilFuncSeparate")) == NULL) || r;
-  r = ((glStencilMaskSeparate = (PFNGLSTENCILMASKSEPARATEPROC)glewGetProcAddress((const GLubyte*)"glStencilMaskSeparate")) == NULL) || r;
-  r = ((glStencilOpSeparate = (PFNGLSTENCILOPSEPARATEPROC)glewGetProcAddress((const GLubyte*)"glStencilOpSeparate")) == NULL) || r;
-  r = ((glUniform1f = (PFNGLUNIFORM1FPROC)glewGetProcAddress((const GLubyte*)"glUniform1f")) == NULL) || r;
-  r = ((glUniform1fv = (PFNGLUNIFORM1FVPROC)glewGetProcAddress((const GLubyte*)"glUniform1fv")) == NULL) || r;
-  r = ((glUniform1i = (PFNGLUNIFORM1IPROC)glewGetProcAddress((const GLubyte*)"glUniform1i")) == NULL) || r;
-  r = ((glUniform1iv = (PFNGLUNIFORM1IVPROC)glewGetProcAddress((const GLubyte*)"glUniform1iv")) == NULL) || r;
-  r = ((glUniform2f = (PFNGLUNIFORM2FPROC)glewGetProcAddress((const GLubyte*)"glUniform2f")) == NULL) || r;
-  r = ((glUniform2fv = (PFNGLUNIFORM2FVPROC)glewGetProcAddress((const GLubyte*)"glUniform2fv")) == NULL) || r;
-  r = ((glUniform2i = (PFNGLUNIFORM2IPROC)glewGetProcAddress((const GLubyte*)"glUniform2i")) == NULL) || r;
-  r = ((glUniform2iv = (PFNGLUNIFORM2IVPROC)glewGetProcAddress((const GLubyte*)"glUniform2iv")) == NULL) || r;
-  r = ((glUniform3f = (PFNGLUNIFORM3FPROC)glewGetProcAddress((const GLubyte*)"glUniform3f")) == NULL) || r;
-  r = ((glUniform3fv = (PFNGLUNIFORM3FVPROC)glewGetProcAddress((const GLubyte*)"glUniform3fv")) == NULL) || r;
-  r = ((glUniform3i = (PFNGLUNIFORM3IPROC)glewGetProcAddress((const GLubyte*)"glUniform3i")) == NULL) || r;
-  r = ((glUniform3iv = (PFNGLUNIFORM3IVPROC)glewGetProcAddress((const GLubyte*)"glUniform3iv")) == NULL) || r;
-  r = ((glUniform4f = (PFNGLUNIFORM4FPROC)glewGetProcAddress((const GLubyte*)"glUniform4f")) == NULL) || r;
-  r = ((glUniform4fv = (PFNGLUNIFORM4FVPROC)glewGetProcAddress((const GLubyte*)"glUniform4fv")) == NULL) || r;
-  r = ((glUniform4i = (PFNGLUNIFORM4IPROC)glewGetProcAddress((const GLubyte*)"glUniform4i")) == NULL) || r;
-  r = ((glUniform4iv = (PFNGLUNIFORM4IVPROC)glewGetProcAddress((const GLubyte*)"glUniform4iv")) == NULL) || r;
-  r = ((glUniformMatrix2fv = (PFNGLUNIFORMMATRIX2FVPROC)glewGetProcAddress((const GLubyte*)"glUniformMatrix2fv")) == NULL) || r;
-  r = ((glUniformMatrix3fv = (PFNGLUNIFORMMATRIX3FVPROC)glewGetProcAddress((const GLubyte*)"glUniformMatrix3fv")) == NULL) || r;
-  r = ((glUniformMatrix4fv = (PFNGLUNIFORMMATRIX4FVPROC)glewGetProcAddress((const GLubyte*)"glUniformMatrix4fv")) == NULL) || r;
-  r = ((glUseProgram = (PFNGLUSEPROGRAMPROC)glewGetProcAddress((const GLubyte*)"glUseProgram")) == NULL) || r;
-  r = ((glValidateProgram = (PFNGLVALIDATEPROGRAMPROC)glewGetProcAddress((const GLubyte*)"glValidateProgram")) == NULL) || r;
-  r = ((glVertexAttrib1d = (PFNGLVERTEXATTRIB1DPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1d")) == NULL) || r;
-  r = ((glVertexAttrib1dv = (PFNGLVERTEXATTRIB1DVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1dv")) == NULL) || r;
-  r = ((glVertexAttrib1f = (PFNGLVERTEXATTRIB1FPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1f")) == NULL) || r;
-  r = ((glVertexAttrib1fv = (PFNGLVERTEXATTRIB1FVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1fv")) == NULL) || r;
-  r = ((glVertexAttrib1s = (PFNGLVERTEXATTRIB1SPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1s")) == NULL) || r;
-  r = ((glVertexAttrib1sv = (PFNGLVERTEXATTRIB1SVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1sv")) == NULL) || r;
-  r = ((glVertexAttrib2d = (PFNGLVERTEXATTRIB2DPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2d")) == NULL) || r;
-  r = ((glVertexAttrib2dv = (PFNGLVERTEXATTRIB2DVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2dv")) == NULL) || r;
-  r = ((glVertexAttrib2f = (PFNGLVERTEXATTRIB2FPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2f")) == NULL) || r;
-  r = ((glVertexAttrib2fv = (PFNGLVERTEXATTRIB2FVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2fv")) == NULL) || r;
-  r = ((glVertexAttrib2s = (PFNGLVERTEXATTRIB2SPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2s")) == NULL) || r;
-  r = ((glVertexAttrib2sv = (PFNGLVERTEXATTRIB2SVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2sv")) == NULL) || r;
-  r = ((glVertexAttrib3d = (PFNGLVERTEXATTRIB3DPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3d")) == NULL) || r;
-  r = ((glVertexAttrib3dv = (PFNGLVERTEXATTRIB3DVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3dv")) == NULL) || r;
-  r = ((glVertexAttrib3f = (PFNGLVERTEXATTRIB3FPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3f")) == NULL) || r;
-  r = ((glVertexAttrib3fv = (PFNGLVERTEXATTRIB3FVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3fv")) == NULL) || r;
-  r = ((glVertexAttrib3s = (PFNGLVERTEXATTRIB3SPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3s")) == NULL) || r;
-  r = ((glVertexAttrib3sv = (PFNGLVERTEXATTRIB3SVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3sv")) == NULL) || r;
-  r = ((glVertexAttrib4Nbv = (PFNGLVERTEXATTRIB4NBVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4Nbv")) == NULL) || r;
-  r = ((glVertexAttrib4Niv = (PFNGLVERTEXATTRIB4NIVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4Niv")) == NULL) || r;
-  r = ((glVertexAttrib4Nsv = (PFNGLVERTEXATTRIB4NSVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4Nsv")) == NULL) || r;
-  r = ((glVertexAttrib4Nub = (PFNGLVERTEXATTRIB4NUBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4Nub")) == NULL) || r;
-  r = ((glVertexAttrib4Nubv = (PFNGLVERTEXATTRIB4NUBVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4Nubv")) == NULL) || r;
-  r = ((glVertexAttrib4Nuiv = (PFNGLVERTEXATTRIB4NUIVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4Nuiv")) == NULL) || r;
-  r = ((glVertexAttrib4Nusv = (PFNGLVERTEXATTRIB4NUSVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4Nusv")) == NULL) || r;
-  r = ((glVertexAttrib4bv = (PFNGLVERTEXATTRIB4BVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4bv")) == NULL) || r;
-  r = ((glVertexAttrib4d = (PFNGLVERTEXATTRIB4DPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4d")) == NULL) || r;
-  r = ((glVertexAttrib4dv = (PFNGLVERTEXATTRIB4DVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4dv")) == NULL) || r;
-  r = ((glVertexAttrib4f = (PFNGLVERTEXATTRIB4FPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4f")) == NULL) || r;
-  r = ((glVertexAttrib4fv = (PFNGLVERTEXATTRIB4FVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4fv")) == NULL) || r;
-  r = ((glVertexAttrib4iv = (PFNGLVERTEXATTRIB4IVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4iv")) == NULL) || r;
-  r = ((glVertexAttrib4s = (PFNGLVERTEXATTRIB4SPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4s")) == NULL) || r;
-  r = ((glVertexAttrib4sv = (PFNGLVERTEXATTRIB4SVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4sv")) == NULL) || r;
-  r = ((glVertexAttrib4ubv = (PFNGLVERTEXATTRIB4UBVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4ubv")) == NULL) || r;
-  r = ((glVertexAttrib4uiv = (PFNGLVERTEXATTRIB4UIVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4uiv")) == NULL) || r;
-  r = ((glVertexAttrib4usv = (PFNGLVERTEXATTRIB4USVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4usv")) == NULL) || r;
-  r = ((glVertexAttribPointer = (PFNGLVERTEXATTRIBPOINTERPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribPointer")) == NULL) || r;
-  return r;
-#endif /* GL_VERSION_2_0 */
-#ifdef GL_3DFX_multisample
-#endif /* GL_3DFX_multisample */
-#ifdef GL_3DFX_tbuffer
-static GLboolean _glewInit_GL_3DFX_tbuffer (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glTbufferMask3DFX = (PFNGLTBUFFERMASK3DFXPROC)glewGetProcAddress((const GLubyte*)"glTbufferMask3DFX")) == NULL) || r;
-  return r;
-#endif /* GL_3DFX_tbuffer */
-#ifdef GL_3DFX_texture_compression_FXT1
-#endif /* GL_3DFX_texture_compression_FXT1 */
-#ifdef GL_APPLE_client_storage
-#endif /* GL_APPLE_client_storage */
-#ifdef GL_APPLE_element_array
-static GLboolean _glewInit_GL_APPLE_element_array (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glDrawElementArrayAPPLE = (PFNGLDRAWELEMENTARRAYAPPLEPROC)glewGetProcAddress((const GLubyte*)"glDrawElementArrayAPPLE")) == NULL) || r;
-  r = ((glDrawRangeElementArrayAPPLE = (PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC)glewGetProcAddress((const GLubyte*)"glDrawRangeElementArrayAPPLE")) == NULL) || r;
-  r = ((glElementPointerAPPLE = (PFNGLELEMENTPOINTERAPPLEPROC)glewGetProcAddress((const GLubyte*)"glElementPointerAPPLE")) == NULL) || r;
-  r = ((glMultiDrawElementArrayAPPLE = (PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC)glewGetProcAddress((const GLubyte*)"glMultiDrawElementArrayAPPLE")) == NULL) || r;
-  r = ((glMultiDrawRangeElementArrayAPPLE = (PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC)glewGetProcAddress((const GLubyte*)"glMultiDrawRangeElementArrayAPPLE")) == NULL) || r;
-  return r;
-#endif /* GL_APPLE_element_array */
-#ifdef GL_APPLE_fence
-static GLboolean _glewInit_GL_APPLE_fence (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glDeleteFencesAPPLE = (PFNGLDELETEFENCESAPPLEPROC)glewGetProcAddress((const GLubyte*)"glDeleteFencesAPPLE")) == NULL) || r;
-  r = ((glFinishFenceAPPLE = (PFNGLFINISHFENCEAPPLEPROC)glewGetProcAddress((const GLubyte*)"glFinishFenceAPPLE")) == NULL) || r;
-  r = ((glFinishObjectAPPLE = (PFNGLFINISHOBJECTAPPLEPROC)glewGetProcAddress((const GLubyte*)"glFinishObjectAPPLE")) == NULL) || r;
-  r = ((glGenFencesAPPLE = (PFNGLGENFENCESAPPLEPROC)glewGetProcAddress((const GLubyte*)"glGenFencesAPPLE")) == NULL) || r;
-  r = ((glIsFenceAPPLE = (PFNGLISFENCEAPPLEPROC)glewGetProcAddress((const GLubyte*)"glIsFenceAPPLE")) == NULL) || r;
-  r = ((glSetFenceAPPLE = (PFNGLSETFENCEAPPLEPROC)glewGetProcAddress((const GLubyte*)"glSetFenceAPPLE")) == NULL) || r;
-  r = ((glTestFenceAPPLE = (PFNGLTESTFENCEAPPLEPROC)glewGetProcAddress((const GLubyte*)"glTestFenceAPPLE")) == NULL) || r;
-  r = ((glTestObjectAPPLE = (PFNGLTESTOBJECTAPPLEPROC)glewGetProcAddress((const GLubyte*)"glTestObjectAPPLE")) == NULL) || r;
-  return r;
-#endif /* GL_APPLE_fence */
-#ifdef GL_APPLE_float_pixels
-#endif /* GL_APPLE_float_pixels */
-#ifdef GL_APPLE_pixel_buffer
-#endif /* GL_APPLE_pixel_buffer */
-#ifdef GL_APPLE_specular_vector
-#endif /* GL_APPLE_specular_vector */
-#ifdef GL_APPLE_texture_range
-static GLboolean _glewInit_GL_APPLE_texture_range (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glGetTexParameterPointervAPPLE = (PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC)glewGetProcAddress((const GLubyte*)"glGetTexParameterPointervAPPLE")) == NULL) || r;
-  r = ((glTextureRangeAPPLE = (PFNGLTEXTURERANGEAPPLEPROC)glewGetProcAddress((const GLubyte*)"glTextureRangeAPPLE")) == NULL) || r;
-  return r;
-#endif /* GL_APPLE_texture_range */
-#ifdef GL_APPLE_transform_hint
-#endif /* GL_APPLE_transform_hint */
-#ifdef GL_APPLE_vertex_array_object
-static GLboolean _glewInit_GL_APPLE_vertex_array_object (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBindVertexArrayAPPLE = (PFNGLBINDVERTEXARRAYAPPLEPROC)glewGetProcAddress((const GLubyte*)"glBindVertexArrayAPPLE")) == NULL) || r;
-  r = ((glDeleteVertexArraysAPPLE = (PFNGLDELETEVERTEXARRAYSAPPLEPROC)glewGetProcAddress((const GLubyte*)"glDeleteVertexArraysAPPLE")) == NULL) || r;
-  r = ((glGenVertexArraysAPPLE = (PFNGLGENVERTEXARRAYSAPPLEPROC)glewGetProcAddress((const GLubyte*)"glGenVertexArraysAPPLE")) == NULL) || r;
-  r = ((glIsVertexArrayAPPLE = (PFNGLISVERTEXARRAYAPPLEPROC)glewGetProcAddress((const GLubyte*)"glIsVertexArrayAPPLE")) == NULL) || r;
-  return r;
-#endif /* GL_APPLE_vertex_array_object */
-#ifdef GL_APPLE_vertex_array_range
-static GLboolean _glewInit_GL_APPLE_vertex_array_range (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glFlushVertexArrayRangeAPPLE = (PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC)glewGetProcAddress((const GLubyte*)"glFlushVertexArrayRangeAPPLE")) == NULL) || r;
-  r = ((glVertexArrayParameteriAPPLE = (PFNGLVERTEXARRAYPARAMETERIAPPLEPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayParameteriAPPLE")) == NULL) || r;
-  r = ((glVertexArrayRangeAPPLE = (PFNGLVERTEXARRAYRANGEAPPLEPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayRangeAPPLE")) == NULL) || r;
-  return r;
-#endif /* GL_APPLE_vertex_array_range */
-#ifdef GL_APPLE_ycbcr_422
-#endif /* GL_APPLE_ycbcr_422 */
-#ifdef GL_ARB_color_buffer_float
-static GLboolean _glewInit_GL_ARB_color_buffer_float (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glClampColorARB = (PFNGLCLAMPCOLORARBPROC)glewGetProcAddress((const GLubyte*)"glClampColorARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_color_buffer_float */
-#ifdef GL_ARB_depth_texture
-#endif /* GL_ARB_depth_texture */
-#ifdef GL_ARB_draw_buffers
-static GLboolean _glewInit_GL_ARB_draw_buffers (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glDrawBuffersARB = (PFNGLDRAWBUFFERSARBPROC)glewGetProcAddress((const GLubyte*)"glDrawBuffersARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_draw_buffers */
-#ifdef GL_ARB_fragment_program
-#endif /* GL_ARB_fragment_program */
-#ifdef GL_ARB_fragment_program_shadow
-#endif /* GL_ARB_fragment_program_shadow */
-#ifdef GL_ARB_fragment_shader
-#endif /* GL_ARB_fragment_shader */
-#ifdef GL_ARB_half_float_pixel
-#endif /* GL_ARB_half_float_pixel */
-#ifdef GL_ARB_imaging
-static GLboolean _glewInit_GL_ARB_imaging (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBlendEquation = (PFNGLBLENDEQUATIONPROC)glewGetProcAddress((const GLubyte*)"glBlendEquation")) == NULL) || r;
-  r = ((glColorSubTable = (PFNGLCOLORSUBTABLEPROC)glewGetProcAddress((const GLubyte*)"glColorSubTable")) == NULL) || r;
-  r = ((glColorTable = (PFNGLCOLORTABLEPROC)glewGetProcAddress((const GLubyte*)"glColorTable")) == NULL) || r;
-  r = ((glColorTableParameterfv = (PFNGLCOLORTABLEPARAMETERFVPROC)glewGetProcAddress((const GLubyte*)"glColorTableParameterfv")) == NULL) || r;
-  r = ((glColorTableParameteriv = (PFNGLCOLORTABLEPARAMETERIVPROC)glewGetProcAddress((const GLubyte*)"glColorTableParameteriv")) == NULL) || r;
-  r = ((glConvolutionFilter1D = (PFNGLCONVOLUTIONFILTER1DPROC)glewGetProcAddress((const GLubyte*)"glConvolutionFilter1D")) == NULL) || r;
-  r = ((glConvolutionFilter2D = (PFNGLCONVOLUTIONFILTER2DPROC)glewGetProcAddress((const GLubyte*)"glConvolutionFilter2D")) == NULL) || r;
-  r = ((glConvolutionParameterf = (PFNGLCONVOLUTIONPARAMETERFPROC)glewGetProcAddress((const GLubyte*)"glConvolutionParameterf")) == NULL) || r;
-  r = ((glConvolutionParameterfv = (PFNGLCONVOLUTIONPARAMETERFVPROC)glewGetProcAddress((const GLubyte*)"glConvolutionParameterfv")) == NULL) || r;
-  r = ((glConvolutionParameteri = (PFNGLCONVOLUTIONPARAMETERIPROC)glewGetProcAddress((const GLubyte*)"glConvolutionParameteri")) == NULL) || r;
-  r = ((glConvolutionParameteriv = (PFNGLCONVOLUTIONPARAMETERIVPROC)glewGetProcAddress((const GLubyte*)"glConvolutionParameteriv")) == NULL) || r;
-  r = ((glCopyColorSubTable = (PFNGLCOPYCOLORSUBTABLEPROC)glewGetProcAddress((const GLubyte*)"glCopyColorSubTable")) == NULL) || r;
-  r = ((glCopyColorTable = (PFNGLCOPYCOLORTABLEPROC)glewGetProcAddress((const GLubyte*)"glCopyColorTable")) == NULL) || r;
-  r = ((glCopyConvolutionFilter1D = (PFNGLCOPYCONVOLUTIONFILTER1DPROC)glewGetProcAddress((const GLubyte*)"glCopyConvolutionFilter1D")) == NULL) || r;
-  r = ((glCopyConvolutionFilter2D = (PFNGLCOPYCONVOLUTIONFILTER2DPROC)glewGetProcAddress((const GLubyte*)"glCopyConvolutionFilter2D")) == NULL) || r;
-  r = ((glGetColorTable = (PFNGLGETCOLORTABLEPROC)glewGetProcAddress((const GLubyte*)"glGetColorTable")) == NULL) || r;
-  r = ((glGetColorTableParameterfv = (PFNGLGETCOLORTABLEPARAMETERFVPROC)glewGetProcAddress((const GLubyte*)"glGetColorTableParameterfv")) == NULL) || r;
-  r = ((glGetColorTableParameteriv = (PFNGLGETCOLORTABLEPARAMETERIVPROC)glewGetProcAddress((const GLubyte*)"glGetColorTableParameteriv")) == NULL) || r;
-  r = ((glGetConvolutionFilter = (PFNGLGETCONVOLUTIONFILTERPROC)glewGetProcAddress((const GLubyte*)"glGetConvolutionFilter")) == NULL) || r;
-  r = ((glGetConvolutionParameterfv = (PFNGLGETCONVOLUTIONPARAMETERFVPROC)glewGetProcAddress((const GLubyte*)"glGetConvolutionParameterfv")) == NULL) || r;
-  r = ((glGetConvolutionParameteriv = (PFNGLGETCONVOLUTIONPARAMETERIVPROC)glewGetProcAddress((const GLubyte*)"glGetConvolutionParameteriv")) == NULL) || r;
-  r = ((glGetHistogram = (PFNGLGETHISTOGRAMPROC)glewGetProcAddress((const GLubyte*)"glGetHistogram")) == NULL) || r;
-  r = ((glGetHistogramParameterfv = (PFNGLGETHISTOGRAMPARAMETERFVPROC)glewGetProcAddress((const GLubyte*)"glGetHistogramParameterfv")) == NULL) || r;
-  r = ((glGetHistogramParameteriv = (PFNGLGETHISTOGRAMPARAMETERIVPROC)glewGetProcAddress((const GLubyte*)"glGetHistogramParameteriv")) == NULL) || r;
-  r = ((glGetMinmax = (PFNGLGETMINMAXPROC)glewGetProcAddress((const GLubyte*)"glGetMinmax")) == NULL) || r;
-  r = ((glGetMinmaxParameterfv = (PFNGLGETMINMAXPARAMETERFVPROC)glewGetProcAddress((const GLubyte*)"glGetMinmaxParameterfv")) == NULL) || r;
-  r = ((glGetMinmaxParameteriv = (PFNGLGETMINMAXPARAMETERIVPROC)glewGetProcAddress((const GLubyte*)"glGetMinmaxParameteriv")) == NULL) || r;
-  r = ((glGetSeparableFilter = (PFNGLGETSEPARABLEFILTERPROC)glewGetProcAddress((const GLubyte*)"glGetSeparableFilter")) == NULL) || r;
-  r = ((glHistogram = (PFNGLHISTOGRAMPROC)glewGetProcAddress((const GLubyte*)"glHistogram")) == NULL) || r;
-  r = ((glMinmax = (PFNGLMINMAXPROC)glewGetProcAddress((const GLubyte*)"glMinmax")) == NULL) || r;
-  r = ((glResetHistogram = (PFNGLRESETHISTOGRAMPROC)glewGetProcAddress((const GLubyte*)"glResetHistogram")) == NULL) || r;
-  r = ((glResetMinmax = (PFNGLRESETMINMAXPROC)glewGetProcAddress((const GLubyte*)"glResetMinmax")) == NULL) || r;
-  r = ((glSeparableFilter2D = (PFNGLSEPARABLEFILTER2DPROC)glewGetProcAddress((const GLubyte*)"glSeparableFilter2D")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_imaging */
-#ifdef GL_ARB_matrix_palette
-static GLboolean _glewInit_GL_ARB_matrix_palette (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glCurrentPaletteMatrixARB = (PFNGLCURRENTPALETTEMATRIXARBPROC)glewGetProcAddress((const GLubyte*)"glCurrentPaletteMatrixARB")) == NULL) || r;
-  r = ((glMatrixIndexPointerARB = (PFNGLMATRIXINDEXPOINTERARBPROC)glewGetProcAddress((const GLubyte*)"glMatrixIndexPointerARB")) == NULL) || r;
-  r = ((glMatrixIndexubvARB = (PFNGLMATRIXINDEXUBVARBPROC)glewGetProcAddress((const GLubyte*)"glMatrixIndexubvARB")) == NULL) || r;
-  r = ((glMatrixIndexuivARB = (PFNGLMATRIXINDEXUIVARBPROC)glewGetProcAddress((const GLubyte*)"glMatrixIndexuivARB")) == NULL) || r;
-  r = ((glMatrixIndexusvARB = (PFNGLMATRIXINDEXUSVARBPROC)glewGetProcAddress((const GLubyte*)"glMatrixIndexusvARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_matrix_palette */
-#ifdef GL_ARB_multisample
-static GLboolean _glewInit_GL_ARB_multisample (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glSampleCoverageARB = (PFNGLSAMPLECOVERAGEARBPROC)glewGetProcAddress((const GLubyte*)"glSampleCoverageARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_multisample */
-#ifdef GL_ARB_multitexture
-static GLboolean _glewInit_GL_ARB_multitexture (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glActiveTextureARB = (PFNGLACTIVETEXTUREARBPROC)glewGetProcAddress((const GLubyte*)"glActiveTextureARB")) == NULL) || r;
-  r = ((glClientActiveTextureARB = (PFNGLCLIENTACTIVETEXTUREARBPROC)glewGetProcAddress((const GLubyte*)"glClientActiveTextureARB")) == NULL) || r;
-  r = ((glMultiTexCoord1dARB = (PFNGLMULTITEXCOORD1DARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1dARB")) == NULL) || r;
-  r = ((glMultiTexCoord1dvARB = (PFNGLMULTITEXCOORD1DVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1dvARB")) == NULL) || r;
-  r = ((glMultiTexCoord1fARB = (PFNGLMULTITEXCOORD1FARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1fARB")) == NULL) || r;
-  r = ((glMultiTexCoord1fvARB = (PFNGLMULTITEXCOORD1FVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1fvARB")) == NULL) || r;
-  r = ((glMultiTexCoord1iARB = (PFNGLMULTITEXCOORD1IARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1iARB")) == NULL) || r;
-  r = ((glMultiTexCoord1ivARB = (PFNGLMULTITEXCOORD1IVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1ivARB")) == NULL) || r;
-  r = ((glMultiTexCoord1sARB = (PFNGLMULTITEXCOORD1SARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1sARB")) == NULL) || r;
-  r = ((glMultiTexCoord1svARB = (PFNGLMULTITEXCOORD1SVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1svARB")) == NULL) || r;
-  r = ((glMultiTexCoord2dARB = (PFNGLMULTITEXCOORD2DARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2dARB")) == NULL) || r;
-  r = ((glMultiTexCoord2dvARB = (PFNGLMULTITEXCOORD2DVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2dvARB")) == NULL) || r;
-  r = ((glMultiTexCoord2fARB = (PFNGLMULTITEXCOORD2FARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2fARB")) == NULL) || r;
-  r = ((glMultiTexCoord2fvARB = (PFNGLMULTITEXCOORD2FVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2fvARB")) == NULL) || r;
-  r = ((glMultiTexCoord2iARB = (PFNGLMULTITEXCOORD2IARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2iARB")) == NULL) || r;
-  r = ((glMultiTexCoord2ivARB = (PFNGLMULTITEXCOORD2IVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2ivARB")) == NULL) || r;
-  r = ((glMultiTexCoord2sARB = (PFNGLMULTITEXCOORD2SARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2sARB")) == NULL) || r;
-  r = ((glMultiTexCoord2svARB = (PFNGLMULTITEXCOORD2SVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2svARB")) == NULL) || r;
-  r = ((glMultiTexCoord3dARB = (PFNGLMULTITEXCOORD3DARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3dARB")) == NULL) || r;
-  r = ((glMultiTexCoord3dvARB = (PFNGLMULTITEXCOORD3DVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3dvARB")) == NULL) || r;
-  r = ((glMultiTexCoord3fARB = (PFNGLMULTITEXCOORD3FARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3fARB")) == NULL) || r;
-  r = ((glMultiTexCoord3fvARB = (PFNGLMULTITEXCOORD3FVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3fvARB")) == NULL) || r;
-  r = ((glMultiTexCoord3iARB = (PFNGLMULTITEXCOORD3IARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3iARB")) == NULL) || r;
-  r = ((glMultiTexCoord3ivARB = (PFNGLMULTITEXCOORD3IVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3ivARB")) == NULL) || r;
-  r = ((glMultiTexCoord3sARB = (PFNGLMULTITEXCOORD3SARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3sARB")) == NULL) || r;
-  r = ((glMultiTexCoord3svARB = (PFNGLMULTITEXCOORD3SVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3svARB")) == NULL) || r;
-  r = ((glMultiTexCoord4dARB = (PFNGLMULTITEXCOORD4DARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4dARB")) == NULL) || r;
-  r = ((glMultiTexCoord4dvARB = (PFNGLMULTITEXCOORD4DVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4dvARB")) == NULL) || r;
-  r = ((glMultiTexCoord4fARB = (PFNGLMULTITEXCOORD4FARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4fARB")) == NULL) || r;
-  r = ((glMultiTexCoord4fvARB = (PFNGLMULTITEXCOORD4FVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4fvARB")) == NULL) || r;
-  r = ((glMultiTexCoord4iARB = (PFNGLMULTITEXCOORD4IARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4iARB")) == NULL) || r;
-  r = ((glMultiTexCoord4ivARB = (PFNGLMULTITEXCOORD4IVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4ivARB")) == NULL) || r;
-  r = ((glMultiTexCoord4sARB = (PFNGLMULTITEXCOORD4SARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4sARB")) == NULL) || r;
-  r = ((glMultiTexCoord4svARB = (PFNGLMULTITEXCOORD4SVARBPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4svARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_multitexture */
-#ifdef GL_ARB_occlusion_query
-static GLboolean _glewInit_GL_ARB_occlusion_query (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBeginQueryARB = (PFNGLBEGINQUERYARBPROC)glewGetProcAddress((const GLubyte*)"glBeginQueryARB")) == NULL) || r;
-  r = ((glDeleteQueriesARB = (PFNGLDELETEQUERIESARBPROC)glewGetProcAddress((const GLubyte*)"glDeleteQueriesARB")) == NULL) || r;
-  r = ((glEndQueryARB = (PFNGLENDQUERYARBPROC)glewGetProcAddress((const GLubyte*)"glEndQueryARB")) == NULL) || r;
-  r = ((glGenQueriesARB = (PFNGLGENQUERIESARBPROC)glewGetProcAddress((const GLubyte*)"glGenQueriesARB")) == NULL) || r;
-  r = ((glGetQueryObjectivARB = (PFNGLGETQUERYOBJECTIVARBPROC)glewGetProcAddress((const GLubyte*)"glGetQueryObjectivARB")) == NULL) || r;
-  r = ((glGetQueryObjectuivARB = (PFNGLGETQUERYOBJECTUIVARBPROC)glewGetProcAddress((const GLubyte*)"glGetQueryObjectuivARB")) == NULL) || r;
-  r = ((glGetQueryivARB = (PFNGLGETQUERYIVARBPROC)glewGetProcAddress((const GLubyte*)"glGetQueryivARB")) == NULL) || r;
-  r = ((glIsQueryARB = (PFNGLISQUERYARBPROC)glewGetProcAddress((const GLubyte*)"glIsQueryARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_occlusion_query */
-#ifdef GL_ARB_pixel_buffer_object
-#endif /* GL_ARB_pixel_buffer_object */
-#ifdef GL_ARB_point_parameters
-static GLboolean _glewInit_GL_ARB_point_parameters (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glPointParameterfARB = (PFNGLPOINTPARAMETERFARBPROC)glewGetProcAddress((const GLubyte*)"glPointParameterfARB")) == NULL) || r;
-  r = ((glPointParameterfvARB = (PFNGLPOINTPARAMETERFVARBPROC)glewGetProcAddress((const GLubyte*)"glPointParameterfvARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_point_parameters */
-#ifdef GL_ARB_point_sprite
-#endif /* GL_ARB_point_sprite */
-#ifdef GL_ARB_shader_objects
-static GLboolean _glewInit_GL_ARB_shader_objects (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glAttachObjectARB = (PFNGLATTACHOBJECTARBPROC)glewGetProcAddress((const GLubyte*)"glAttachObjectARB")) == NULL) || r;
-  r = ((glCompileShaderARB = (PFNGLCOMPILESHADERARBPROC)glewGetProcAddress((const GLubyte*)"glCompileShaderARB")) == NULL) || r;
-  r = ((glCreateProgramObjectARB = (PFNGLCREATEPROGRAMOBJECTARBPROC)glewGetProcAddress((const GLubyte*)"glCreateProgramObjectARB")) == NULL) || r;
-  r = ((glCreateShaderObjectARB = (PFNGLCREATESHADEROBJECTARBPROC)glewGetProcAddress((const GLubyte*)"glCreateShaderObjectARB")) == NULL) || r;
-  r = ((glDeleteObjectARB = (PFNGLDELETEOBJECTARBPROC)glewGetProcAddress((const GLubyte*)"glDeleteObjectARB")) == NULL) || r;
-  r = ((glDetachObjectARB = (PFNGLDETACHOBJECTARBPROC)glewGetProcAddress((const GLubyte*)"glDetachObjectARB")) == NULL) || r;
-  r = ((glGetActiveUniformARB = (PFNGLGETACTIVEUNIFORMARBPROC)glewGetProcAddress((const GLubyte*)"glGetActiveUniformARB")) == NULL) || r;
-  r = ((glGetAttachedObjectsARB = (PFNGLGETATTACHEDOBJECTSARBPROC)glewGetProcAddress((const GLubyte*)"glGetAttachedObjectsARB")) == NULL) || r;
-  r = ((glGetHandleARB = (PFNGLGETHANDLEARBPROC)glewGetProcAddress((const GLubyte*)"glGetHandleARB")) == NULL) || r;
-  r = ((glGetInfoLogARB = (PFNGLGETINFOLOGARBPROC)glewGetProcAddress((const GLubyte*)"glGetInfoLogARB")) == NULL) || r;
-  r = ((glGetObjectParameterfvARB = (PFNGLGETOBJECTPARAMETERFVARBPROC)glewGetProcAddress((const GLubyte*)"glGetObjectParameterfvARB")) == NULL) || r;
-  r = ((glGetObjectParameterivARB = (PFNGLGETOBJECTPARAMETERIVARBPROC)glewGetProcAddress((const GLubyte*)"glGetObjectParameterivARB")) == NULL) || r;
-  r = ((glGetShaderSourceARB = (PFNGLGETSHADERSOURCEARBPROC)glewGetProcAddress((const GLubyte*)"glGetShaderSourceARB")) == NULL) || r;
-  r = ((glGetUniformLocationARB = (PFNGLGETUNIFORMLOCATIONARBPROC)glewGetProcAddress((const GLubyte*)"glGetUniformLocationARB")) == NULL) || r;
-  r = ((glGetUniformfvARB = (PFNGLGETUNIFORMFVARBPROC)glewGetProcAddress((const GLubyte*)"glGetUniformfvARB")) == NULL) || r;
-  r = ((glGetUniformivARB = (PFNGLGETUNIFORMIVARBPROC)glewGetProcAddress((const GLubyte*)"glGetUniformivARB")) == NULL) || r;
-  r = ((glLinkProgramARB = (PFNGLLINKPROGRAMARBPROC)glewGetProcAddress((const GLubyte*)"glLinkProgramARB")) == NULL) || r;
-  r = ((glShaderSourceARB = (PFNGLSHADERSOURCEARBPROC)glewGetProcAddress((const GLubyte*)"glShaderSourceARB")) == NULL) || r;
-  r = ((glUniform1fARB = (PFNGLUNIFORM1FARBPROC)glewGetProcAddress((const GLubyte*)"glUniform1fARB")) == NULL) || r;
-  r = ((glUniform1fvARB = (PFNGLUNIFORM1FVARBPROC)glewGetProcAddress((const GLubyte*)"glUniform1fvARB")) == NULL) || r;
-  r = ((glUniform1iARB = (PFNGLUNIFORM1IARBPROC)glewGetProcAddress((const GLubyte*)"glUniform1iARB")) == NULL) || r;
-  r = ((glUniform1ivARB = (PFNGLUNIFORM1IVARBPROC)glewGetProcAddress((const GLubyte*)"glUniform1ivARB")) == NULL) || r;
-  r = ((glUniform2fARB = (PFNGLUNIFORM2FARBPROC)glewGetProcAddress((const GLubyte*)"glUniform2fARB")) == NULL) || r;
-  r = ((glUniform2fvARB = (PFNGLUNIFORM2FVARBPROC)glewGetProcAddress((const GLubyte*)"glUniform2fvARB")) == NULL) || r;
-  r = ((glUniform2iARB = (PFNGLUNIFORM2IARBPROC)glewGetProcAddress((const GLubyte*)"glUniform2iARB")) == NULL) || r;
-  r = ((glUniform2ivARB = (PFNGLUNIFORM2IVARBPROC)glewGetProcAddress((const GLubyte*)"glUniform2ivARB")) == NULL) || r;
-  r = ((glUniform3fARB = (PFNGLUNIFORM3FARBPROC)glewGetProcAddress((const GLubyte*)"glUniform3fARB")) == NULL) || r;
-  r = ((glUniform3fvARB = (PFNGLUNIFORM3FVARBPROC)glewGetProcAddress((const GLubyte*)"glUniform3fvARB")) == NULL) || r;
-  r = ((glUniform3iARB = (PFNGLUNIFORM3IARBPROC)glewGetProcAddress((const GLubyte*)"glUniform3iARB")) == NULL) || r;
-  r = ((glUniform3ivARB = (PFNGLUNIFORM3IVARBPROC)glewGetProcAddress((const GLubyte*)"glUniform3ivARB")) == NULL) || r;
-  r = ((glUniform4fARB = (PFNGLUNIFORM4FARBPROC)glewGetProcAddress((const GLubyte*)"glUniform4fARB")) == NULL) || r;
-  r = ((glUniform4fvARB = (PFNGLUNIFORM4FVARBPROC)glewGetProcAddress((const GLubyte*)"glUniform4fvARB")) == NULL) || r;
-  r = ((glUniform4iARB = (PFNGLUNIFORM4IARBPROC)glewGetProcAddress((const GLubyte*)"glUniform4iARB")) == NULL) || r;
-  r = ((glUniform4ivARB = (PFNGLUNIFORM4IVARBPROC)glewGetProcAddress((const GLubyte*)"glUniform4ivARB")) == NULL) || r;
-  r = ((glUniformMatrix2fvARB = (PFNGLUNIFORMMATRIX2FVARBPROC)glewGetProcAddress((const GLubyte*)"glUniformMatrix2fvARB")) == NULL) || r;
-  r = ((glUniformMatrix3fvARB = (PFNGLUNIFORMMATRIX3FVARBPROC)glewGetProcAddress((const GLubyte*)"glUniformMatrix3fvARB")) == NULL) || r;
-  r = ((glUniformMatrix4fvARB = (PFNGLUNIFORMMATRIX4FVARBPROC)glewGetProcAddress((const GLubyte*)"glUniformMatrix4fvARB")) == NULL) || r;
-  r = ((glUseProgramObjectARB = (PFNGLUSEPROGRAMOBJECTARBPROC)glewGetProcAddress((const GLubyte*)"glUseProgramObjectARB")) == NULL) || r;
-  r = ((glValidateProgramARB = (PFNGLVALIDATEPROGRAMARBPROC)glewGetProcAddress((const GLubyte*)"glValidateProgramARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_shader_objects */
-#ifdef GL_ARB_shading_language_100
-#endif /* GL_ARB_shading_language_100 */
-#ifdef GL_ARB_shadow
-#endif /* GL_ARB_shadow */
-#ifdef GL_ARB_shadow_ambient
-#endif /* GL_ARB_shadow_ambient */
-#ifdef GL_ARB_texture_border_clamp
-#endif /* GL_ARB_texture_border_clamp */
-#ifdef GL_ARB_texture_compression
-static GLboolean _glewInit_GL_ARB_texture_compression (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glCompressedTexImage1DARB = (PFNGLCOMPRESSEDTEXIMAGE1DARBPROC)glewGetProcAddress((const GLubyte*)"glCompressedTexImage1DARB")) == NULL) || r;
-  r = ((glCompressedTexImage2DARB = (PFNGLCOMPRESSEDTEXIMAGE2DARBPROC)glewGetProcAddress((const GLubyte*)"glCompressedTexImage2DARB")) == NULL) || r;
-  r = ((glCompressedTexImage3DARB = (PFNGLCOMPRESSEDTEXIMAGE3DARBPROC)glewGetProcAddress((const GLubyte*)"glCompressedTexImage3DARB")) == NULL) || r;
-  r = ((glCompressedTexSubImage1DARB = (PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC)glewGetProcAddress((const GLubyte*)"glCompressedTexSubImage1DARB")) == NULL) || r;
-  r = ((glCompressedTexSubImage2DARB = (PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC)glewGetProcAddress((const GLubyte*)"glCompressedTexSubImage2DARB")) == NULL) || r;
-  r = ((glCompressedTexSubImage3DARB = (PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC)glewGetProcAddress((const GLubyte*)"glCompressedTexSubImage3DARB")) == NULL) || r;
-  r = ((glGetCompressedTexImageARB = (PFNGLGETCOMPRESSEDTEXIMAGEARBPROC)glewGetProcAddress((const GLubyte*)"glGetCompressedTexImageARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_texture_compression */
-#ifdef GL_ARB_texture_cube_map
-#endif /* GL_ARB_texture_cube_map */
-#ifdef GL_ARB_texture_env_add
-#endif /* GL_ARB_texture_env_add */
-#ifdef GL_ARB_texture_env_combine
-#endif /* GL_ARB_texture_env_combine */
-#ifdef GL_ARB_texture_env_crossbar
-#endif /* GL_ARB_texture_env_crossbar */
-#ifdef GL_ARB_texture_env_dot3
-#endif /* GL_ARB_texture_env_dot3 */
-#ifdef GL_ARB_texture_float
-#endif /* GL_ARB_texture_float */
-#ifdef GL_ARB_texture_mirrored_repeat
-#endif /* GL_ARB_texture_mirrored_repeat */
-#ifdef GL_ARB_texture_non_power_of_two
-#endif /* GL_ARB_texture_non_power_of_two */
-#ifdef GL_ARB_texture_rectangle
-#endif /* GL_ARB_texture_rectangle */
-#ifdef GL_ARB_transpose_matrix
-static GLboolean _glewInit_GL_ARB_transpose_matrix (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glLoadTransposeMatrixdARB = (PFNGLLOADTRANSPOSEMATRIXDARBPROC)glewGetProcAddress((const GLubyte*)"glLoadTransposeMatrixdARB")) == NULL) || r;
-  r = ((glLoadTransposeMatrixfARB = (PFNGLLOADTRANSPOSEMATRIXFARBPROC)glewGetProcAddress((const GLubyte*)"glLoadTransposeMatrixfARB")) == NULL) || r;
-  r = ((glMultTransposeMatrixdARB = (PFNGLMULTTRANSPOSEMATRIXDARBPROC)glewGetProcAddress((const GLubyte*)"glMultTransposeMatrixdARB")) == NULL) || r;
-  r = ((glMultTransposeMatrixfARB = (PFNGLMULTTRANSPOSEMATRIXFARBPROC)glewGetProcAddress((const GLubyte*)"glMultTransposeMatrixfARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_transpose_matrix */
-#ifdef GL_ARB_vertex_blend
-static GLboolean _glewInit_GL_ARB_vertex_blend (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glVertexBlendARB = (PFNGLVERTEXBLENDARBPROC)glewGetProcAddress((const GLubyte*)"glVertexBlendARB")) == NULL) || r;
-  r = ((glWeightPointerARB = (PFNGLWEIGHTPOINTERARBPROC)glewGetProcAddress((const GLubyte*)"glWeightPointerARB")) == NULL) || r;
-  r = ((glWeightbvARB = (PFNGLWEIGHTBVARBPROC)glewGetProcAddress((const GLubyte*)"glWeightbvARB")) == NULL) || r;
-  r = ((glWeightdvARB = (PFNGLWEIGHTDVARBPROC)glewGetProcAddress((const GLubyte*)"glWeightdvARB")) == NULL) || r;
-  r = ((glWeightfvARB = (PFNGLWEIGHTFVARBPROC)glewGetProcAddress((const GLubyte*)"glWeightfvARB")) == NULL) || r;
-  r = ((glWeightivARB = (PFNGLWEIGHTIVARBPROC)glewGetProcAddress((const GLubyte*)"glWeightivARB")) == NULL) || r;
-  r = ((glWeightsvARB = (PFNGLWEIGHTSVARBPROC)glewGetProcAddress((const GLubyte*)"glWeightsvARB")) == NULL) || r;
-  r = ((glWeightubvARB = (PFNGLWEIGHTUBVARBPROC)glewGetProcAddress((const GLubyte*)"glWeightubvARB")) == NULL) || r;
-  r = ((glWeightuivARB = (PFNGLWEIGHTUIVARBPROC)glewGetProcAddress((const GLubyte*)"glWeightuivARB")) == NULL) || r;
-  r = ((glWeightusvARB = (PFNGLWEIGHTUSVARBPROC)glewGetProcAddress((const GLubyte*)"glWeightusvARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_vertex_blend */
-#ifdef GL_ARB_vertex_buffer_object
-static GLboolean _glewInit_GL_ARB_vertex_buffer_object (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBindBufferARB = (PFNGLBINDBUFFERARBPROC)glewGetProcAddress((const GLubyte*)"glBindBufferARB")) == NULL) || r;
-  r = ((glBufferDataARB = (PFNGLBUFFERDATAARBPROC)glewGetProcAddress((const GLubyte*)"glBufferDataARB")) == NULL) || r;
-  r = ((glBufferSubDataARB = (PFNGLBUFFERSUBDATAARBPROC)glewGetProcAddress((const GLubyte*)"glBufferSubDataARB")) == NULL) || r;
-  r = ((glDeleteBuffersARB = (PFNGLDELETEBUFFERSARBPROC)glewGetProcAddress((const GLubyte*)"glDeleteBuffersARB")) == NULL) || r;
-  r = ((glGenBuffersARB = (PFNGLGENBUFFERSARBPROC)glewGetProcAddress((const GLubyte*)"glGenBuffersARB")) == NULL) || r;
-  r = ((glGetBufferParameterivARB = (PFNGLGETBUFFERPARAMETERIVARBPROC)glewGetProcAddress((const GLubyte*)"glGetBufferParameterivARB")) == NULL) || r;
-  r = ((glGetBufferPointervARB = (PFNGLGETBUFFERPOINTERVARBPROC)glewGetProcAddress((const GLubyte*)"glGetBufferPointervARB")) == NULL) || r;
-  r = ((glGetBufferSubDataARB = (PFNGLGETBUFFERSUBDATAARBPROC)glewGetProcAddress((const GLubyte*)"glGetBufferSubDataARB")) == NULL) || r;
-  r = ((glIsBufferARB = (PFNGLISBUFFERARBPROC)glewGetProcAddress((const GLubyte*)"glIsBufferARB")) == NULL) || r;
-  r = ((glMapBufferARB = (PFNGLMAPBUFFERARBPROC)glewGetProcAddress((const GLubyte*)"glMapBufferARB")) == NULL) || r;
-  r = ((glUnmapBufferARB = (PFNGLUNMAPBUFFERARBPROC)glewGetProcAddress((const GLubyte*)"glUnmapBufferARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_vertex_buffer_object */
-#ifdef GL_ARB_vertex_program
-static GLboolean _glewInit_GL_ARB_vertex_program (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBindProgramARB = (PFNGLBINDPROGRAMARBPROC)glewGetProcAddress((const GLubyte*)"glBindProgramARB")) == NULL) || r;
-  r = ((glDeleteProgramsARB = (PFNGLDELETEPROGRAMSARBPROC)glewGetProcAddress((const GLubyte*)"glDeleteProgramsARB")) == NULL) || r;
-  r = ((glDisableVertexAttribArrayARB = (PFNGLDISABLEVERTEXATTRIBARRAYARBPROC)glewGetProcAddress((const GLubyte*)"glDisableVertexAttribArrayARB")) == NULL) || r;
-  r = ((glEnableVertexAttribArrayARB = (PFNGLENABLEVERTEXATTRIBARRAYARBPROC)glewGetProcAddress((const GLubyte*)"glEnableVertexAttribArrayARB")) == NULL) || r;
-  r = ((glGenProgramsARB = (PFNGLGENPROGRAMSARBPROC)glewGetProcAddress((const GLubyte*)"glGenProgramsARB")) == NULL) || r;
-  r = ((glGetProgramEnvParameterdvARB = (PFNGLGETPROGRAMENVPARAMETERDVARBPROC)glewGetProcAddress((const GLubyte*)"glGetProgramEnvParameterdvARB")) == NULL) || r;
-  r = ((glGetProgramEnvParameterfvARB = (PFNGLGETPROGRAMENVPARAMETERFVARBPROC)glewGetProcAddress((const GLubyte*)"glGetProgramEnvParameterfvARB")) == NULL) || r;
-  r = ((glGetProgramLocalParameterdvARB = (PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC)glewGetProcAddress((const GLubyte*)"glGetProgramLocalParameterdvARB")) == NULL) || r;
-  r = ((glGetProgramLocalParameterfvARB = (PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC)glewGetProcAddress((const GLubyte*)"glGetProgramLocalParameterfvARB")) == NULL) || r;
-  r = ((glGetProgramStringARB = (PFNGLGETPROGRAMSTRINGARBPROC)glewGetProcAddress((const GLubyte*)"glGetProgramStringARB")) == NULL) || r;
-  r = ((glGetProgramivARB = (PFNGLGETPROGRAMIVARBPROC)glewGetProcAddress((const GLubyte*)"glGetProgramivARB")) == NULL) || r;
-  r = ((glGetVertexAttribPointervARB = (PFNGLGETVERTEXATTRIBPOINTERVARBPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribPointervARB")) == NULL) || r;
-  r = ((glGetVertexAttribdvARB = (PFNGLGETVERTEXATTRIBDVARBPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribdvARB")) == NULL) || r;
-  r = ((glGetVertexAttribfvARB = (PFNGLGETVERTEXATTRIBFVARBPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribfvARB")) == NULL) || r;
-  r = ((glGetVertexAttribivARB = (PFNGLGETVERTEXATTRIBIVARBPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribivARB")) == NULL) || r;
-  r = ((glIsProgramARB = (PFNGLISPROGRAMARBPROC)glewGetProcAddress((const GLubyte*)"glIsProgramARB")) == NULL) || r;
-  r = ((glProgramEnvParameter4dARB = (PFNGLPROGRAMENVPARAMETER4DARBPROC)glewGetProcAddress((const GLubyte*)"glProgramEnvParameter4dARB")) == NULL) || r;
-  r = ((glProgramEnvParameter4dvARB = (PFNGLPROGRAMENVPARAMETER4DVARBPROC)glewGetProcAddress((const GLubyte*)"glProgramEnvParameter4dvARB")) == NULL) || r;
-  r = ((glProgramEnvParameter4fARB = (PFNGLPROGRAMENVPARAMETER4FARBPROC)glewGetProcAddress((const GLubyte*)"glProgramEnvParameter4fARB")) == NULL) || r;
-  r = ((glProgramEnvParameter4fvARB = (PFNGLPROGRAMENVPARAMETER4FVARBPROC)glewGetProcAddress((const GLubyte*)"glProgramEnvParameter4fvARB")) == NULL) || r;
-  r = ((glProgramLocalParameter4dARB = (PFNGLPROGRAMLOCALPARAMETER4DARBPROC)glewGetProcAddress((const GLubyte*)"glProgramLocalParameter4dARB")) == NULL) || r;
-  r = ((glProgramLocalParameter4dvARB = (PFNGLPROGRAMLOCALPARAMETER4DVARBPROC)glewGetProcAddress((const GLubyte*)"glProgramLocalParameter4dvARB")) == NULL) || r;
-  r = ((glProgramLocalParameter4fARB = (PFNGLPROGRAMLOCALPARAMETER4FARBPROC)glewGetProcAddress((const GLubyte*)"glProgramLocalParameter4fARB")) == NULL) || r;
-  r = ((glProgramLocalParameter4fvARB = (PFNGLPROGRAMLOCALPARAMETER4FVARBPROC)glewGetProcAddress((const GLubyte*)"glProgramLocalParameter4fvARB")) == NULL) || r;
-  r = ((glProgramStringARB = (PFNGLPROGRAMSTRINGARBPROC)glewGetProcAddress((const GLubyte*)"glProgramStringARB")) == NULL) || r;
-  r = ((glVertexAttrib1dARB = (PFNGLVERTEXATTRIB1DARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1dARB")) == NULL) || r;
-  r = ((glVertexAttrib1dvARB = (PFNGLVERTEXATTRIB1DVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1dvARB")) == NULL) || r;
-  r = ((glVertexAttrib1fARB = (PFNGLVERTEXATTRIB1FARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1fARB")) == NULL) || r;
-  r = ((glVertexAttrib1fvARB = (PFNGLVERTEXATTRIB1FVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1fvARB")) == NULL) || r;
-  r = ((glVertexAttrib1sARB = (PFNGLVERTEXATTRIB1SARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1sARB")) == NULL) || r;
-  r = ((glVertexAttrib1svARB = (PFNGLVERTEXATTRIB1SVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1svARB")) == NULL) || r;
-  r = ((glVertexAttrib2dARB = (PFNGLVERTEXATTRIB2DARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2dARB")) == NULL) || r;
-  r = ((glVertexAttrib2dvARB = (PFNGLVERTEXATTRIB2DVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2dvARB")) == NULL) || r;
-  r = ((glVertexAttrib2fARB = (PFNGLVERTEXATTRIB2FARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2fARB")) == NULL) || r;
-  r = ((glVertexAttrib2fvARB = (PFNGLVERTEXATTRIB2FVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2fvARB")) == NULL) || r;
-  r = ((glVertexAttrib2sARB = (PFNGLVERTEXATTRIB2SARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2sARB")) == NULL) || r;
-  r = ((glVertexAttrib2svARB = (PFNGLVERTEXATTRIB2SVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2svARB")) == NULL) || r;
-  r = ((glVertexAttrib3dARB = (PFNGLVERTEXATTRIB3DARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3dARB")) == NULL) || r;
-  r = ((glVertexAttrib3dvARB = (PFNGLVERTEXATTRIB3DVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3dvARB")) == NULL) || r;
-  r = ((glVertexAttrib3fARB = (PFNGLVERTEXATTRIB3FARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3fARB")) == NULL) || r;
-  r = ((glVertexAttrib3fvARB = (PFNGLVERTEXATTRIB3FVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3fvARB")) == NULL) || r;
-  r = ((glVertexAttrib3sARB = (PFNGLVERTEXATTRIB3SARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3sARB")) == NULL) || r;
-  r = ((glVertexAttrib3svARB = (PFNGLVERTEXATTRIB3SVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3svARB")) == NULL) || r;
-  r = ((glVertexAttrib4NbvARB = (PFNGLVERTEXATTRIB4NBVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4NbvARB")) == NULL) || r;
-  r = ((glVertexAttrib4NivARB = (PFNGLVERTEXATTRIB4NIVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4NivARB")) == NULL) || r;
-  r = ((glVertexAttrib4NsvARB = (PFNGLVERTEXATTRIB4NSVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4NsvARB")) == NULL) || r;
-  r = ((glVertexAttrib4NubARB = (PFNGLVERTEXATTRIB4NUBARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4NubARB")) == NULL) || r;
-  r = ((glVertexAttrib4NubvARB = (PFNGLVERTEXATTRIB4NUBVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4NubvARB")) == NULL) || r;
-  r = ((glVertexAttrib4NuivARB = (PFNGLVERTEXATTRIB4NUIVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4NuivARB")) == NULL) || r;
-  r = ((glVertexAttrib4NusvARB = (PFNGLVERTEXATTRIB4NUSVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4NusvARB")) == NULL) || r;
-  r = ((glVertexAttrib4bvARB = (PFNGLVERTEXATTRIB4BVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4bvARB")) == NULL) || r;
-  r = ((glVertexAttrib4dARB = (PFNGLVERTEXATTRIB4DARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4dARB")) == NULL) || r;
-  r = ((glVertexAttrib4dvARB = (PFNGLVERTEXATTRIB4DVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4dvARB")) == NULL) || r;
-  r = ((glVertexAttrib4fARB = (PFNGLVERTEXATTRIB4FARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4fARB")) == NULL) || r;
-  r = ((glVertexAttrib4fvARB = (PFNGLVERTEXATTRIB4FVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4fvARB")) == NULL) || r;
-  r = ((glVertexAttrib4ivARB = (PFNGLVERTEXATTRIB4IVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4ivARB")) == NULL) || r;
-  r = ((glVertexAttrib4sARB = (PFNGLVERTEXATTRIB4SARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4sARB")) == NULL) || r;
-  r = ((glVertexAttrib4svARB = (PFNGLVERTEXATTRIB4SVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4svARB")) == NULL) || r;
-  r = ((glVertexAttrib4ubvARB = (PFNGLVERTEXATTRIB4UBVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4ubvARB")) == NULL) || r;
-  r = ((glVertexAttrib4uivARB = (PFNGLVERTEXATTRIB4UIVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4uivARB")) == NULL) || r;
-  r = ((glVertexAttrib4usvARB = (PFNGLVERTEXATTRIB4USVARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4usvARB")) == NULL) || r;
-  r = ((glVertexAttribPointerARB = (PFNGLVERTEXATTRIBPOINTERARBPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribPointerARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_vertex_program */
-#ifdef GL_ARB_vertex_shader
-static GLboolean _glewInit_GL_ARB_vertex_shader (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBindAttribLocationARB = (PFNGLBINDATTRIBLOCATIONARBPROC)glewGetProcAddress((const GLubyte*)"glBindAttribLocationARB")) == NULL) || r;
-  r = ((glGetActiveAttribARB = (PFNGLGETACTIVEATTRIBARBPROC)glewGetProcAddress((const GLubyte*)"glGetActiveAttribARB")) == NULL) || r;
-  r = ((glGetAttribLocationARB = (PFNGLGETATTRIBLOCATIONARBPROC)glewGetProcAddress((const GLubyte*)"glGetAttribLocationARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_vertex_shader */
-#ifdef GL_ARB_window_pos
-static GLboolean _glewInit_GL_ARB_window_pos (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glWindowPos2dARB = (PFNGLWINDOWPOS2DARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2dARB")) == NULL) || r;
-  r = ((glWindowPos2dvARB = (PFNGLWINDOWPOS2DVARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2dvARB")) == NULL) || r;
-  r = ((glWindowPos2fARB = (PFNGLWINDOWPOS2FARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2fARB")) == NULL) || r;
-  r = ((glWindowPos2fvARB = (PFNGLWINDOWPOS2FVARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2fvARB")) == NULL) || r;
-  r = ((glWindowPos2iARB = (PFNGLWINDOWPOS2IARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2iARB")) == NULL) || r;
-  r = ((glWindowPos2ivARB = (PFNGLWINDOWPOS2IVARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2ivARB")) == NULL) || r;
-  r = ((glWindowPos2sARB = (PFNGLWINDOWPOS2SARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2sARB")) == NULL) || r;
-  r = ((glWindowPos2svARB = (PFNGLWINDOWPOS2SVARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2svARB")) == NULL) || r;
-  r = ((glWindowPos3dARB = (PFNGLWINDOWPOS3DARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3dARB")) == NULL) || r;
-  r = ((glWindowPos3dvARB = (PFNGLWINDOWPOS3DVARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3dvARB")) == NULL) || r;
-  r = ((glWindowPos3fARB = (PFNGLWINDOWPOS3FARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3fARB")) == NULL) || r;
-  r = ((glWindowPos3fvARB = (PFNGLWINDOWPOS3FVARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3fvARB")) == NULL) || r;
-  r = ((glWindowPos3iARB = (PFNGLWINDOWPOS3IARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3iARB")) == NULL) || r;
-  r = ((glWindowPos3ivARB = (PFNGLWINDOWPOS3IVARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3ivARB")) == NULL) || r;
-  r = ((glWindowPos3sARB = (PFNGLWINDOWPOS3SARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3sARB")) == NULL) || r;
-  r = ((glWindowPos3svARB = (PFNGLWINDOWPOS3SVARBPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3svARB")) == NULL) || r;
-  return r;
-#endif /* GL_ARB_window_pos */
-#ifdef GL_ATIX_point_sprites
-#endif /* GL_ATIX_point_sprites */
-#ifdef GL_ATIX_texture_env_combine3
-#endif /* GL_ATIX_texture_env_combine3 */
-#ifdef GL_ATIX_texture_env_route
-#endif /* GL_ATIX_texture_env_route */
-#ifdef GL_ATIX_vertex_shader_output_point_size
-#endif /* GL_ATIX_vertex_shader_output_point_size */
-#ifdef GL_ATI_draw_buffers
-static GLboolean _glewInit_GL_ATI_draw_buffers (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glDrawBuffersATI = (PFNGLDRAWBUFFERSATIPROC)glewGetProcAddress((const GLubyte*)"glDrawBuffersATI")) == NULL) || r;
-  return r;
-#endif /* GL_ATI_draw_buffers */
-#ifdef GL_ATI_element_array
-static GLboolean _glewInit_GL_ATI_element_array (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glDrawElementArrayATI = (PFNGLDRAWELEMENTARRAYATIPROC)glewGetProcAddress((const GLubyte*)"glDrawElementArrayATI")) == NULL) || r;
-  r = ((glDrawRangeElementArrayATI = (PFNGLDRAWRANGEELEMENTARRAYATIPROC)glewGetProcAddress((const GLubyte*)"glDrawRangeElementArrayATI")) == NULL) || r;
-  r = ((glElementPointerATI = (PFNGLELEMENTPOINTERATIPROC)glewGetProcAddress((const GLubyte*)"glElementPointerATI")) == NULL) || r;
-  return r;
-#endif /* GL_ATI_element_array */
-#ifdef GL_ATI_envmap_bumpmap
-static GLboolean _glewInit_GL_ATI_envmap_bumpmap (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glGetTexBumpParameterfvATI = (PFNGLGETTEXBUMPPARAMETERFVATIPROC)glewGetProcAddress((const GLubyte*)"glGetTexBumpParameterfvATI")) == NULL) || r;
-  r = ((glGetTexBumpParameterivATI = (PFNGLGETTEXBUMPPARAMETERIVATIPROC)glewGetProcAddress((const GLubyte*)"glGetTexBumpParameterivATI")) == NULL) || r;
-  r = ((glTexBumpParameterfvATI = (PFNGLTEXBUMPPARAMETERFVATIPROC)glewGetProcAddress((const GLubyte*)"glTexBumpParameterfvATI")) == NULL) || r;
-  r = ((glTexBumpParameterivATI = (PFNGLTEXBUMPPARAMETERIVATIPROC)glewGetProcAddress((const GLubyte*)"glTexBumpParameterivATI")) == NULL) || r;
-  return r;
-#endif /* GL_ATI_envmap_bumpmap */
-#ifdef GL_ATI_fragment_shader
-static GLboolean _glewInit_GL_ATI_fragment_shader (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glAlphaFragmentOp1ATI = (PFNGLALPHAFRAGMENTOP1ATIPROC)glewGetProcAddress((const GLubyte*)"glAlphaFragmentOp1ATI")) == NULL) || r;
-  r = ((glAlphaFragmentOp2ATI = (PFNGLALPHAFRAGMENTOP2ATIPROC)glewGetProcAddress((const GLubyte*)"glAlphaFragmentOp2ATI")) == NULL) || r;
-  r = ((glAlphaFragmentOp3ATI = (PFNGLALPHAFRAGMENTOP3ATIPROC)glewGetProcAddress((const GLubyte*)"glAlphaFragmentOp3ATI")) == NULL) || r;
-  r = ((glBeginFragmentShaderATI = (PFNGLBEGINFRAGMENTSHADERATIPROC)glewGetProcAddress((const GLubyte*)"glBeginFragmentShaderATI")) == NULL) || r;
-  r = ((glBindFragmentShaderATI = (PFNGLBINDFRAGMENTSHADERATIPROC)glewGetProcAddress((const GLubyte*)"glBindFragmentShaderATI")) == NULL) || r;
-  r = ((glColorFragmentOp1ATI = (PFNGLCOLORFRAGMENTOP1ATIPROC)glewGetProcAddress((const GLubyte*)"glColorFragmentOp1ATI")) == NULL) || r;
-  r = ((glColorFragmentOp2ATI = (PFNGLCOLORFRAGMENTOP2ATIPROC)glewGetProcAddress((const GLubyte*)"glColorFragmentOp2ATI")) == NULL) || r;
-  r = ((glColorFragmentOp3ATI = (PFNGLCOLORFRAGMENTOP3ATIPROC)glewGetProcAddress((const GLubyte*)"glColorFragmentOp3ATI")) == NULL) || r;
-  r = ((glDeleteFragmentShaderATI = (PFNGLDELETEFRAGMENTSHADERATIPROC)glewGetProcAddress((const GLubyte*)"glDeleteFragmentShaderATI")) == NULL) || r;
-  r = ((glEndFragmentShaderATI = (PFNGLENDFRAGMENTSHADERATIPROC)glewGetProcAddress((const GLubyte*)"glEndFragmentShaderATI")) == NULL) || r;
-  r = ((glGenFragmentShadersATI = (PFNGLGENFRAGMENTSHADERSATIPROC)glewGetProcAddress((const GLubyte*)"glGenFragmentShadersATI")) == NULL) || r;
-  r = ((glPassTexCoordATI = (PFNGLPASSTEXCOORDATIPROC)glewGetProcAddress((const GLubyte*)"glPassTexCoordATI")) == NULL) || r;
-  r = ((glSampleMapATI = (PFNGLSAMPLEMAPATIPROC)glewGetProcAddress((const GLubyte*)"glSampleMapATI")) == NULL) || r;
-  r = ((glSetFragmentShaderConstantATI = (PFNGLSETFRAGMENTSHADERCONSTANTATIPROC)glewGetProcAddress((const GLubyte*)"glSetFragmentShaderConstantATI")) == NULL) || r;
-  return r;
-#endif /* GL_ATI_fragment_shader */
-#ifdef GL_ATI_map_object_buffer
-static GLboolean _glewInit_GL_ATI_map_object_buffer (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glMapObjectBufferATI = (PFNGLMAPOBJECTBUFFERATIPROC)glewGetProcAddress((const GLubyte*)"glMapObjectBufferATI")) == NULL) || r;
-  r = ((glUnmapObjectBufferATI = (PFNGLUNMAPOBJECTBUFFERATIPROC)glewGetProcAddress((const GLubyte*)"glUnmapObjectBufferATI")) == NULL) || r;
-  return r;
-#endif /* GL_ATI_map_object_buffer */
-#ifdef GL_ATI_pn_triangles
-static GLboolean _glewInit_GL_ATI_pn_triangles (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glPNTrianglesfATI = (PFNGLPNTRIANGLESFATIPROC)glewGetProcAddress((const GLubyte*)"glPNTrianglesfATI")) == NULL) || r;
-  r = ((glPNTrianglesiATI = (PFNGLPNTRIANGLESIATIPROC)glewGetProcAddress((const GLubyte*)"glPNTrianglesiATI")) == NULL) || r;
-  return r;
-#endif /* GL_ATI_pn_triangles */
-#ifdef GL_ATI_separate_stencil
-static GLboolean _glewInit_GL_ATI_separate_stencil (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glStencilFuncSeparateATI = (PFNGLSTENCILFUNCSEPARATEATIPROC)glewGetProcAddress((const GLubyte*)"glStencilFuncSeparateATI")) == NULL) || r;
-  r = ((glStencilOpSeparateATI = (PFNGLSTENCILOPSEPARATEATIPROC)glewGetProcAddress((const GLubyte*)"glStencilOpSeparateATI")) == NULL) || r;
-  return r;
-#endif /* GL_ATI_separate_stencil */
-#ifdef GL_ATI_text_fragment_shader
-#endif /* GL_ATI_text_fragment_shader */
-#ifdef GL_ATI_texture_compression_3dc
-#endif /* GL_ATI_texture_compression_3dc */
-#ifdef GL_ATI_texture_env_combine3
-#endif /* GL_ATI_texture_env_combine3 */
-#ifdef GL_ATI_texture_float
-#endif /* GL_ATI_texture_float */
-#ifdef GL_ATI_texture_mirror_once
-#endif /* GL_ATI_texture_mirror_once */
-#ifdef GL_ATI_vertex_array_object
-static GLboolean _glewInit_GL_ATI_vertex_array_object (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glArrayObjectATI = (PFNGLARRAYOBJECTATIPROC)glewGetProcAddress((const GLubyte*)"glArrayObjectATI")) == NULL) || r;
-  r = ((glFreeObjectBufferATI = (PFNGLFREEOBJECTBUFFERATIPROC)glewGetProcAddress((const GLubyte*)"glFreeObjectBufferATI")) == NULL) || r;
-  r = ((glGetArrayObjectfvATI = (PFNGLGETARRAYOBJECTFVATIPROC)glewGetProcAddress((const GLubyte*)"glGetArrayObjectfvATI")) == NULL) || r;
-  r = ((glGetArrayObjectivATI = (PFNGLGETARRAYOBJECTIVATIPROC)glewGetProcAddress((const GLubyte*)"glGetArrayObjectivATI")) == NULL) || r;
-  r = ((glGetObjectBufferfvATI = (PFNGLGETOBJECTBUFFERFVATIPROC)glewGetProcAddress((const GLubyte*)"glGetObjectBufferfvATI")) == NULL) || r;
-  r = ((glGetObjectBufferivATI = (PFNGLGETOBJECTBUFFERIVATIPROC)glewGetProcAddress((const GLubyte*)"glGetObjectBufferivATI")) == NULL) || r;
-  r = ((glGetVariantArrayObjectfvATI = (PFNGLGETVARIANTARRAYOBJECTFVATIPROC)glewGetProcAddress((const GLubyte*)"glGetVariantArrayObjectfvATI")) == NULL) || r;
-  r = ((glGetVariantArrayObjectivATI = (PFNGLGETVARIANTARRAYOBJECTIVATIPROC)glewGetProcAddress((const GLubyte*)"glGetVariantArrayObjectivATI")) == NULL) || r;
-  r = ((glIsObjectBufferATI = (PFNGLISOBJECTBUFFERATIPROC)glewGetProcAddress((const GLubyte*)"glIsObjectBufferATI")) == NULL) || r;
-  r = ((glNewObjectBufferATI = (PFNGLNEWOBJECTBUFFERATIPROC)glewGetProcAddress((const GLubyte*)"glNewObjectBufferATI")) == NULL) || r;
-  r = ((glUpdateObjectBufferATI = (PFNGLUPDATEOBJECTBUFFERATIPROC)glewGetProcAddress((const GLubyte*)"glUpdateObjectBufferATI")) == NULL) || r;
-  r = ((glVariantArrayObjectATI = (PFNGLVARIANTARRAYOBJECTATIPROC)glewGetProcAddress((const GLubyte*)"glVariantArrayObjectATI")) == NULL) || r;
-  return r;
-#endif /* GL_ATI_vertex_array_object */
-#ifdef GL_ATI_vertex_attrib_array_object
-static GLboolean _glewInit_GL_ATI_vertex_attrib_array_object (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glGetVertexAttribArrayObjectfvATI = (PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribArrayObjectfvATI")) == NULL) || r;
-  r = ((glGetVertexAttribArrayObjectivATI = (PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribArrayObjectivATI")) == NULL) || r;
-  r = ((glVertexAttribArrayObjectATI = (PFNGLVERTEXATTRIBARRAYOBJECTATIPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribArrayObjectATI")) == NULL) || r;
-  return r;
-#endif /* GL_ATI_vertex_attrib_array_object */
-#ifdef GL_ATI_vertex_streams
-static GLboolean _glewInit_GL_ATI_vertex_streams (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glClientActiveVertexStreamATI = (PFNGLCLIENTACTIVEVERTEXSTREAMATIPROC)glewGetProcAddress((const GLubyte*)"glClientActiveVertexStreamATI")) == NULL) || r;
-  r = ((glNormalStream3bATI = (PFNGLNORMALSTREAM3BATIPROC)glewGetProcAddress((const GLubyte*)"glNormalStream3bATI")) == NULL) || r;
-  r = ((glNormalStream3bvATI = (PFNGLNORMALSTREAM3BVATIPROC)glewGetProcAddress((const GLubyte*)"glNormalStream3bvATI")) == NULL) || r;
-  r = ((glNormalStream3dATI = (PFNGLNORMALSTREAM3DATIPROC)glewGetProcAddress((const GLubyte*)"glNormalStream3dATI")) == NULL) || r;
-  r = ((glNormalStream3dvATI = (PFNGLNORMALSTREAM3DVATIPROC)glewGetProcAddress((const GLubyte*)"glNormalStream3dvATI")) == NULL) || r;
-  r = ((glNormalStream3fATI = (PFNGLNORMALSTREAM3FATIPROC)glewGetProcAddress((const GLubyte*)"glNormalStream3fATI")) == NULL) || r;
-  r = ((glNormalStream3fvATI = (PFNGLNORMALSTREAM3FVATIPROC)glewGetProcAddress((const GLubyte*)"glNormalStream3fvATI")) == NULL) || r;
-  r = ((glNormalStream3iATI = (PFNGLNORMALSTREAM3IATIPROC)glewGetProcAddress((const GLubyte*)"glNormalStream3iATI")) == NULL) || r;
-  r = ((glNormalStream3ivATI = (PFNGLNORMALSTREAM3IVATIPROC)glewGetProcAddress((const GLubyte*)"glNormalStream3ivATI")) == NULL) || r;
-  r = ((glNormalStream3sATI = (PFNGLNORMALSTREAM3SATIPROC)glewGetProcAddress((const GLubyte*)"glNormalStream3sATI")) == NULL) || r;
-  r = ((glNormalStream3svATI = (PFNGLNORMALSTREAM3SVATIPROC)glewGetProcAddress((const GLubyte*)"glNormalStream3svATI")) == NULL) || r;
-  r = ((glVertexBlendEnvfATI = (PFNGLVERTEXBLENDENVFATIPROC)glewGetProcAddress((const GLubyte*)"glVertexBlendEnvfATI")) == NULL) || r;
-  r = ((glVertexBlendEnviATI = (PFNGLVERTEXBLENDENVIATIPROC)glewGetProcAddress((const GLubyte*)"glVertexBlendEnviATI")) == NULL) || r;
-  r = ((glVertexStream2dATI = (PFNGLVERTEXSTREAM2DATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream2dATI")) == NULL) || r;
-  r = ((glVertexStream2dvATI = (PFNGLVERTEXSTREAM2DVATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream2dvATI")) == NULL) || r;
-  r = ((glVertexStream2fATI = (PFNGLVERTEXSTREAM2FATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream2fATI")) == NULL) || r;
-  r = ((glVertexStream2fvATI = (PFNGLVERTEXSTREAM2FVATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream2fvATI")) == NULL) || r;
-  r = ((glVertexStream2iATI = (PFNGLVERTEXSTREAM2IATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream2iATI")) == NULL) || r;
-  r = ((glVertexStream2ivATI = (PFNGLVERTEXSTREAM2IVATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream2ivATI")) == NULL) || r;
-  r = ((glVertexStream2sATI = (PFNGLVERTEXSTREAM2SATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream2sATI")) == NULL) || r;
-  r = ((glVertexStream2svATI = (PFNGLVERTEXSTREAM2SVATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream2svATI")) == NULL) || r;
-  r = ((glVertexStream3dATI = (PFNGLVERTEXSTREAM3DATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream3dATI")) == NULL) || r;
-  r = ((glVertexStream3dvATI = (PFNGLVERTEXSTREAM3DVATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream3dvATI")) == NULL) || r;
-  r = ((glVertexStream3fATI = (PFNGLVERTEXSTREAM3FATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream3fATI")) == NULL) || r;
-  r = ((glVertexStream3fvATI = (PFNGLVERTEXSTREAM3FVATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream3fvATI")) == NULL) || r;
-  r = ((glVertexStream3iATI = (PFNGLVERTEXSTREAM3IATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream3iATI")) == NULL) || r;
-  r = ((glVertexStream3ivATI = (PFNGLVERTEXSTREAM3IVATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream3ivATI")) == NULL) || r;
-  r = ((glVertexStream3sATI = (PFNGLVERTEXSTREAM3SATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream3sATI")) == NULL) || r;
-  r = ((glVertexStream3svATI = (PFNGLVERTEXSTREAM3SVATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream3svATI")) == NULL) || r;
-  r = ((glVertexStream4dATI = (PFNGLVERTEXSTREAM4DATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream4dATI")) == NULL) || r;
-  r = ((glVertexStream4dvATI = (PFNGLVERTEXSTREAM4DVATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream4dvATI")) == NULL) || r;
-  r = ((glVertexStream4fATI = (PFNGLVERTEXSTREAM4FATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream4fATI")) == NULL) || r;
-  r = ((glVertexStream4fvATI = (PFNGLVERTEXSTREAM4FVATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream4fvATI")) == NULL) || r;
-  r = ((glVertexStream4iATI = (PFNGLVERTEXSTREAM4IATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream4iATI")) == NULL) || r;
-  r = ((glVertexStream4ivATI = (PFNGLVERTEXSTREAM4IVATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream4ivATI")) == NULL) || r;
-  r = ((glVertexStream4sATI = (PFNGLVERTEXSTREAM4SATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream4sATI")) == NULL) || r;
-  r = ((glVertexStream4svATI = (PFNGLVERTEXSTREAM4SVATIPROC)glewGetProcAddress((const GLubyte*)"glVertexStream4svATI")) == NULL) || r;
-  return r;
-#endif /* GL_ATI_vertex_streams */
-#ifdef GL_EXT_422_pixels
-#endif /* GL_EXT_422_pixels */
-#ifdef GL_EXT_Cg_shader
-#endif /* GL_EXT_Cg_shader */
-#ifdef GL_EXT_abgr
-#endif /* GL_EXT_abgr */
-#ifdef GL_EXT_bgra
-#endif /* GL_EXT_bgra */
-#ifdef GL_EXT_blend_color
-static GLboolean _glewInit_GL_EXT_blend_color (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBlendColorEXT = (PFNGLBLENDCOLOREXTPROC)glewGetProcAddress((const GLubyte*)"glBlendColorEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_blend_color */
-#ifdef GL_EXT_blend_equation_separate
-static GLboolean _glewInit_GL_EXT_blend_equation_separate (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBlendEquationSeparateEXT = (PFNGLBLENDEQUATIONSEPARATEEXTPROC)glewGetProcAddress((const GLubyte*)"glBlendEquationSeparateEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_blend_equation_separate */
-#ifdef GL_EXT_blend_func_separate
-static GLboolean _glewInit_GL_EXT_blend_func_separate (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBlendFuncSeparateEXT = (PFNGLBLENDFUNCSEPARATEEXTPROC)glewGetProcAddress((const GLubyte*)"glBlendFuncSeparateEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_blend_func_separate */
-#ifdef GL_EXT_blend_logic_op
-#endif /* GL_EXT_blend_logic_op */
-#ifdef GL_EXT_blend_minmax
-static GLboolean _glewInit_GL_EXT_blend_minmax (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBlendEquationEXT = (PFNGLBLENDEQUATIONEXTPROC)glewGetProcAddress((const GLubyte*)"glBlendEquationEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_blend_minmax */
-#ifdef GL_EXT_blend_subtract
-#endif /* GL_EXT_blend_subtract */
-#ifdef GL_EXT_clip_volume_hint
-#endif /* GL_EXT_clip_volume_hint */
-#ifdef GL_EXT_cmyka
-#endif /* GL_EXT_cmyka */
-#ifdef GL_EXT_color_subtable
-static GLboolean _glewInit_GL_EXT_color_subtable (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glColorSubTableEXT = (PFNGLCOLORSUBTABLEEXTPROC)glewGetProcAddress((const GLubyte*)"glColorSubTableEXT")) == NULL) || r;
-  r = ((glCopyColorSubTableEXT = (PFNGLCOPYCOLORSUBTABLEEXTPROC)glewGetProcAddress((const GLubyte*)"glCopyColorSubTableEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_color_subtable */
-#ifdef GL_EXT_compiled_vertex_array
-static GLboolean _glewInit_GL_EXT_compiled_vertex_array (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glLockArraysEXT = (PFNGLLOCKARRAYSEXTPROC)glewGetProcAddress((const GLubyte*)"glLockArraysEXT")) == NULL) || r;
-  r = ((glUnlockArraysEXT = (PFNGLUNLOCKARRAYSEXTPROC)glewGetProcAddress((const GLubyte*)"glUnlockArraysEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_compiled_vertex_array */
-#ifdef GL_EXT_convolution
-static GLboolean _glewInit_GL_EXT_convolution (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glConvolutionFilter1DEXT = (PFNGLCONVOLUTIONFILTER1DEXTPROC)glewGetProcAddress((const GLubyte*)"glConvolutionFilter1DEXT")) == NULL) || r;
-  r = ((glConvolutionFilter2DEXT = (PFNGLCONVOLUTIONFILTER2DEXTPROC)glewGetProcAddress((const GLubyte*)"glConvolutionFilter2DEXT")) == NULL) || r;
-  r = ((glConvolutionParameterfEXT = (PFNGLCONVOLUTIONPARAMETERFEXTPROC)glewGetProcAddress((const GLubyte*)"glConvolutionParameterfEXT")) == NULL) || r;
-  r = ((glConvolutionParameterfvEXT = (PFNGLCONVOLUTIONPARAMETERFVEXTPROC)glewGetProcAddress((const GLubyte*)"glConvolutionParameterfvEXT")) == NULL) || r;
-  r = ((glConvolutionParameteriEXT = (PFNGLCONVOLUTIONPARAMETERIEXTPROC)glewGetProcAddress((const GLubyte*)"glConvolutionParameteriEXT")) == NULL) || r;
-  r = ((glConvolutionParameterivEXT = (PFNGLCONVOLUTIONPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glConvolutionParameterivEXT")) == NULL) || r;
-  r = ((glCopyConvolutionFilter1DEXT = (PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC)glewGetProcAddress((const GLubyte*)"glCopyConvolutionFilter1DEXT")) == NULL) || r;
-  r = ((glCopyConvolutionFilter2DEXT = (PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC)glewGetProcAddress((const GLubyte*)"glCopyConvolutionFilter2DEXT")) == NULL) || r;
-  r = ((glGetConvolutionFilterEXT = (PFNGLGETCONVOLUTIONFILTEREXTPROC)glewGetProcAddress((const GLubyte*)"glGetConvolutionFilterEXT")) == NULL) || r;
-  r = ((glGetConvolutionParameterfvEXT = (PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetConvolutionParameterfvEXT")) == NULL) || r;
-  r = ((glGetConvolutionParameterivEXT = (PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetConvolutionParameterivEXT")) == NULL) || r;
-  r = ((glGetSeparableFilterEXT = (PFNGLGETSEPARABLEFILTEREXTPROC)glewGetProcAddress((const GLubyte*)"glGetSeparableFilterEXT")) == NULL) || r;
-  r = ((glSeparableFilter2DEXT = (PFNGLSEPARABLEFILTER2DEXTPROC)glewGetProcAddress((const GLubyte*)"glSeparableFilter2DEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_convolution */
-#ifdef GL_EXT_coordinate_frame
-static GLboolean _glewInit_GL_EXT_coordinate_frame (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBinormalPointerEXT = (PFNGLBINORMALPOINTEREXTPROC)glewGetProcAddress((const GLubyte*)"glBinormalPointerEXT")) == NULL) || r;
-  r = ((glTangentPointerEXT = (PFNGLTANGENTPOINTEREXTPROC)glewGetProcAddress((const GLubyte*)"glTangentPointerEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_coordinate_frame */
-#ifdef GL_EXT_copy_texture
-static GLboolean _glewInit_GL_EXT_copy_texture (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glCopyTexImage1DEXT = (PFNGLCOPYTEXIMAGE1DEXTPROC)glewGetProcAddress((const GLubyte*)"glCopyTexImage1DEXT")) == NULL) || r;
-  r = ((glCopyTexImage2DEXT = (PFNGLCOPYTEXIMAGE2DEXTPROC)glewGetProcAddress((const GLubyte*)"glCopyTexImage2DEXT")) == NULL) || r;
-  r = ((glCopyTexSubImage1DEXT = (PFNGLCOPYTEXSUBIMAGE1DEXTPROC)glewGetProcAddress((const GLubyte*)"glCopyTexSubImage1DEXT")) == NULL) || r;
-  r = ((glCopyTexSubImage2DEXT = (PFNGLCOPYTEXSUBIMAGE2DEXTPROC)glewGetProcAddress((const GLubyte*)"glCopyTexSubImage2DEXT")) == NULL) || r;
-  r = ((glCopyTexSubImage3DEXT = (PFNGLCOPYTEXSUBIMAGE3DEXTPROC)glewGetProcAddress((const GLubyte*)"glCopyTexSubImage3DEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_copy_texture */
-#ifdef GL_EXT_cull_vertex
-static GLboolean _glewInit_GL_EXT_cull_vertex (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glCullParameterdvEXT = (PFNGLCULLPARAMETERDVEXTPROC)glewGetProcAddress((const GLubyte*)"glCullParameterdvEXT")) == NULL) || r;
-  r = ((glCullParameterfvEXT = (PFNGLCULLPARAMETERFVEXTPROC)glewGetProcAddress((const GLubyte*)"glCullParameterfvEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_cull_vertex */
-#ifdef GL_EXT_depth_bounds_test
-static GLboolean _glewInit_GL_EXT_depth_bounds_test (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glDepthBoundsEXT = (PFNGLDEPTHBOUNDSEXTPROC)glewGetProcAddress((const GLubyte*)"glDepthBoundsEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_depth_bounds_test */
-#ifdef GL_EXT_draw_range_elements
-static GLboolean _glewInit_GL_EXT_draw_range_elements (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glDrawRangeElementsEXT = (PFNGLDRAWRANGEELEMENTSEXTPROC)glewGetProcAddress((const GLubyte*)"glDrawRangeElementsEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_draw_range_elements */
-#ifdef GL_EXT_fog_coord
-static GLboolean _glewInit_GL_EXT_fog_coord (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glFogCoordPointerEXT = (PFNGLFOGCOORDPOINTEREXTPROC)glewGetProcAddress((const GLubyte*)"glFogCoordPointerEXT")) == NULL) || r;
-  r = ((glFogCoorddEXT = (PFNGLFOGCOORDDEXTPROC)glewGetProcAddress((const GLubyte*)"glFogCoorddEXT")) == NULL) || r;
-  r = ((glFogCoorddvEXT = (PFNGLFOGCOORDDVEXTPROC)glewGetProcAddress((const GLubyte*)"glFogCoorddvEXT")) == NULL) || r;
-  r = ((glFogCoordfEXT = (PFNGLFOGCOORDFEXTPROC)glewGetProcAddress((const GLubyte*)"glFogCoordfEXT")) == NULL) || r;
-  r = ((glFogCoordfvEXT = (PFNGLFOGCOORDFVEXTPROC)glewGetProcAddress((const GLubyte*)"glFogCoordfvEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_fog_coord */
-#ifdef GL_EXT_fragment_lighting
-static GLboolean _glewInit_GL_EXT_fragment_lighting (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glFragmentColorMaterialEXT = (PFNGLFRAGMENTCOLORMATERIALEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentColorMaterialEXT")) == NULL) || r;
-  r = ((glFragmentLightModelfEXT = (PFNGLFRAGMENTLIGHTMODELFEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightModelfEXT")) == NULL) || r;
-  r = ((glFragmentLightModelfvEXT = (PFNGLFRAGMENTLIGHTMODELFVEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightModelfvEXT")) == NULL) || r;
-  r = ((glFragmentLightModeliEXT = (PFNGLFRAGMENTLIGHTMODELIEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightModeliEXT")) == NULL) || r;
-  r = ((glFragmentLightModelivEXT = (PFNGLFRAGMENTLIGHTMODELIVEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightModelivEXT")) == NULL) || r;
-  r = ((glFragmentLightfEXT = (PFNGLFRAGMENTLIGHTFEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightfEXT")) == NULL) || r;
-  r = ((glFragmentLightfvEXT = (PFNGLFRAGMENTLIGHTFVEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightfvEXT")) == NULL) || r;
-  r = ((glFragmentLightiEXT = (PFNGLFRAGMENTLIGHTIEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightiEXT")) == NULL) || r;
-  r = ((glFragmentLightivEXT = (PFNGLFRAGMENTLIGHTIVEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightivEXT")) == NULL) || r;
-  r = ((glFragmentMaterialfEXT = (PFNGLFRAGMENTMATERIALFEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentMaterialfEXT")) == NULL) || r;
-  r = ((glFragmentMaterialfvEXT = (PFNGLFRAGMENTMATERIALFVEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentMaterialfvEXT")) == NULL) || r;
-  r = ((glFragmentMaterialiEXT = (PFNGLFRAGMENTMATERIALIEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentMaterialiEXT")) == NULL) || r;
-  r = ((glFragmentMaterialivEXT = (PFNGLFRAGMENTMATERIALIVEXTPROC)glewGetProcAddress((const GLubyte*)"glFragmentMaterialivEXT")) == NULL) || r;
-  r = ((glGetFragmentLightfvEXT = (PFNGLGETFRAGMENTLIGHTFVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetFragmentLightfvEXT")) == NULL) || r;
-  r = ((glGetFragmentLightivEXT = (PFNGLGETFRAGMENTLIGHTIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetFragmentLightivEXT")) == NULL) || r;
-  r = ((glGetFragmentMaterialfvEXT = (PFNGLGETFRAGMENTMATERIALFVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetFragmentMaterialfvEXT")) == NULL) || r;
-  r = ((glGetFragmentMaterialivEXT = (PFNGLGETFRAGMENTMATERIALIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetFragmentMaterialivEXT")) == NULL) || r;
-  r = ((glLightEnviEXT = (PFNGLLIGHTENVIEXTPROC)glewGetProcAddress((const GLubyte*)"glLightEnviEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_fragment_lighting */
-#ifdef GL_EXT_framebuffer_blit
-static GLboolean _glewInit_GL_EXT_framebuffer_blit (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBlitFramebufferEXT = (PFNGLBLITFRAMEBUFFEREXTPROC)glewGetProcAddress((const GLubyte*)"glBlitFramebufferEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_framebuffer_blit */
-#ifdef GL_EXT_framebuffer_multisample
-static GLboolean _glewInit_GL_EXT_framebuffer_multisample (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glRenderbufferStorageMultisampleEXT = (PFNGLRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC)glewGetProcAddress((const GLubyte*)"glRenderbufferStorageMultisampleEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_framebuffer_multisample */
-#ifdef GL_EXT_framebuffer_object
-static GLboolean _glewInit_GL_EXT_framebuffer_object (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBindFramebufferEXT = (PFNGLBINDFRAMEBUFFEREXTPROC)glewGetProcAddress((const GLubyte*)"glBindFramebufferEXT")) == NULL) || r;
-  r = ((glBindRenderbufferEXT = (PFNGLBINDRENDERBUFFEREXTPROC)glewGetProcAddress((const GLubyte*)"glBindRenderbufferEXT")) == NULL) || r;
-  r = ((glCheckFramebufferStatusEXT = (PFNGLCHECKFRAMEBUFFERSTATUSEXTPROC)glewGetProcAddress((const GLubyte*)"glCheckFramebufferStatusEXT")) == NULL) || r;
-  r = ((glDeleteFramebuffersEXT = (PFNGLDELETEFRAMEBUFFERSEXTPROC)glewGetProcAddress((const GLubyte*)"glDeleteFramebuffersEXT")) == NULL) || r;
-  r = ((glDeleteRenderbuffersEXT = (PFNGLDELETERENDERBUFFERSEXTPROC)glewGetProcAddress((const GLubyte*)"glDeleteRenderbuffersEXT")) == NULL) || r;
-  r = ((glFramebufferRenderbufferEXT = (PFNGLFRAMEBUFFERRENDERBUFFEREXTPROC)glewGetProcAddress((const GLubyte*)"glFramebufferRenderbufferEXT")) == NULL) || r;
-  r = ((glFramebufferTexture1DEXT = (PFNGLFRAMEBUFFERTEXTURE1DEXTPROC)glewGetProcAddress((const GLubyte*)"glFramebufferTexture1DEXT")) == NULL) || r;
-  r = ((glFramebufferTexture2DEXT = (PFNGLFRAMEBUFFERTEXTURE2DEXTPROC)glewGetProcAddress((const GLubyte*)"glFramebufferTexture2DEXT")) == NULL) || r;
-  r = ((glFramebufferTexture3DEXT = (PFNGLFRAMEBUFFERTEXTURE3DEXTPROC)glewGetProcAddress((const GLubyte*)"glFramebufferTexture3DEXT")) == NULL) || r;
-  r = ((glGenFramebuffersEXT = (PFNGLGENFRAMEBUFFERSEXTPROC)glewGetProcAddress((const GLubyte*)"glGenFramebuffersEXT")) == NULL) || r;
-  r = ((glGenRenderbuffersEXT = (PFNGLGENRENDERBUFFERSEXTPROC)glewGetProcAddress((const GLubyte*)"glGenRenderbuffersEXT")) == NULL) || r;
-  r = ((glGenerateMipmapEXT = (PFNGLGENERATEMIPMAPEXTPROC)glewGetProcAddress((const GLubyte*)"glGenerateMipmapEXT")) == NULL) || r;
-  r = ((glGetFramebufferAttachmentParameterivEXT = (PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetFramebufferAttachmentParameterivEXT")) == NULL) || r;
-  r = ((glGetRenderbufferParameterivEXT = (PFNGLGETRENDERBUFFERPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetRenderbufferParameterivEXT")) == NULL) || r;
-  r = ((glIsFramebufferEXT = (PFNGLISFRAMEBUFFEREXTPROC)glewGetProcAddress((const GLubyte*)"glIsFramebufferEXT")) == NULL) || r;
-  r = ((glIsRenderbufferEXT = (PFNGLISRENDERBUFFEREXTPROC)glewGetProcAddress((const GLubyte*)"glIsRenderbufferEXT")) == NULL) || r;
-  r = ((glRenderbufferStorageEXT = (PFNGLRENDERBUFFERSTORAGEEXTPROC)glewGetProcAddress((const GLubyte*)"glRenderbufferStorageEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_framebuffer_object */
-#ifdef GL_EXT_histogram
-static GLboolean _glewInit_GL_EXT_histogram (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glGetHistogramEXT = (PFNGLGETHISTOGRAMEXTPROC)glewGetProcAddress((const GLubyte*)"glGetHistogramEXT")) == NULL) || r;
-  r = ((glGetHistogramParameterfvEXT = (PFNGLGETHISTOGRAMPARAMETERFVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetHistogramParameterfvEXT")) == NULL) || r;
-  r = ((glGetHistogramParameterivEXT = (PFNGLGETHISTOGRAMPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetHistogramParameterivEXT")) == NULL) || r;
-  r = ((glGetMinmaxEXT = (PFNGLGETMINMAXEXTPROC)glewGetProcAddress((const GLubyte*)"glGetMinmaxEXT")) == NULL) || r;
-  r = ((glGetMinmaxParameterfvEXT = (PFNGLGETMINMAXPARAMETERFVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetMinmaxParameterfvEXT")) == NULL) || r;
-  r = ((glGetMinmaxParameterivEXT = (PFNGLGETMINMAXPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetMinmaxParameterivEXT")) == NULL) || r;
-  r = ((glHistogramEXT = (PFNGLHISTOGRAMEXTPROC)glewGetProcAddress((const GLubyte*)"glHistogramEXT")) == NULL) || r;
-  r = ((glMinmaxEXT = (PFNGLMINMAXEXTPROC)glewGetProcAddress((const GLubyte*)"glMinmaxEXT")) == NULL) || r;
-  r = ((glResetHistogramEXT = (PFNGLRESETHISTOGRAMEXTPROC)glewGetProcAddress((const GLubyte*)"glResetHistogramEXT")) == NULL) || r;
-  r = ((glResetMinmaxEXT = (PFNGLRESETMINMAXEXTPROC)glewGetProcAddress((const GLubyte*)"glResetMinmaxEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_histogram */
-#ifdef GL_EXT_index_array_formats
-#endif /* GL_EXT_index_array_formats */
-#ifdef GL_EXT_index_func
-static GLboolean _glewInit_GL_EXT_index_func (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glIndexFuncEXT = (PFNGLINDEXFUNCEXTPROC)glewGetProcAddress((const GLubyte*)"glIndexFuncEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_index_func */
-#ifdef GL_EXT_index_material
-static GLboolean _glewInit_GL_EXT_index_material (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glIndexMaterialEXT = (PFNGLINDEXMATERIALEXTPROC)glewGetProcAddress((const GLubyte*)"glIndexMaterialEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_index_material */
-#ifdef GL_EXT_index_texture
-#endif /* GL_EXT_index_texture */
-#ifdef GL_EXT_light_texture
-static GLboolean _glewInit_GL_EXT_light_texture (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glApplyTextureEXT = (PFNGLAPPLYTEXTUREEXTPROC)glewGetProcAddress((const GLubyte*)"glApplyTextureEXT")) == NULL) || r;
-  r = ((glTextureLightEXT = (PFNGLTEXTURELIGHTEXTPROC)glewGetProcAddress((const GLubyte*)"glTextureLightEXT")) == NULL) || r;
-  r = ((glTextureMaterialEXT = (PFNGLTEXTUREMATERIALEXTPROC)glewGetProcAddress((const GLubyte*)"glTextureMaterialEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_light_texture */
-#ifdef GL_EXT_misc_attribute
-#endif /* GL_EXT_misc_attribute */
-#ifdef GL_EXT_multi_draw_arrays
-static GLboolean _glewInit_GL_EXT_multi_draw_arrays (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glMultiDrawArraysEXT = (PFNGLMULTIDRAWARRAYSEXTPROC)glewGetProcAddress((const GLubyte*)"glMultiDrawArraysEXT")) == NULL) || r;
-  r = ((glMultiDrawElementsEXT = (PFNGLMULTIDRAWELEMENTSEXTPROC)glewGetProcAddress((const GLubyte*)"glMultiDrawElementsEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_multi_draw_arrays */
-#ifdef GL_EXT_multisample
-static GLboolean _glewInit_GL_EXT_multisample (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glSampleMaskEXT = (PFNGLSAMPLEMASKEXTPROC)glewGetProcAddress((const GLubyte*)"glSampleMaskEXT")) == NULL) || r;
-  r = ((glSamplePatternEXT = (PFNGLSAMPLEPATTERNEXTPROC)glewGetProcAddress((const GLubyte*)"glSamplePatternEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_multisample */
-#ifdef GL_EXT_packed_depth_stencil
-#endif /* GL_EXT_packed_depth_stencil */
-#ifdef GL_EXT_packed_pixels
-#endif /* GL_EXT_packed_pixels */
-#ifdef GL_EXT_paletted_texture
-static GLboolean _glewInit_GL_EXT_paletted_texture (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glColorTableEXT = (PFNGLCOLORTABLEEXTPROC)glewGetProcAddress((const GLubyte*)"glColorTableEXT")) == NULL) || r;
-  r = ((glGetColorTableEXT = (PFNGLGETCOLORTABLEEXTPROC)glewGetProcAddress((const GLubyte*)"glGetColorTableEXT")) == NULL) || r;
-  r = ((glGetColorTableParameterfvEXT = (PFNGLGETCOLORTABLEPARAMETERFVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetColorTableParameterfvEXT")) == NULL) || r;
-  r = ((glGetColorTableParameterivEXT = (PFNGLGETCOLORTABLEPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetColorTableParameterivEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_paletted_texture */
-#ifdef GL_EXT_pixel_buffer_object
-#endif /* GL_EXT_pixel_buffer_object */
-#ifdef GL_EXT_pixel_transform
-static GLboolean _glewInit_GL_EXT_pixel_transform (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glGetPixelTransformParameterfvEXT = (PFNGLGETPIXELTRANSFORMPARAMETERFVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetPixelTransformParameterfvEXT")) == NULL) || r;
-  r = ((glGetPixelTransformParameterivEXT = (PFNGLGETPIXELTRANSFORMPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetPixelTransformParameterivEXT")) == NULL) || r;
-  r = ((glPixelTransformParameterfEXT = (PFNGLPIXELTRANSFORMPARAMETERFEXTPROC)glewGetProcAddress((const GLubyte*)"glPixelTransformParameterfEXT")) == NULL) || r;
-  r = ((glPixelTransformParameterfvEXT = (PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC)glewGetProcAddress((const GLubyte*)"glPixelTransformParameterfvEXT")) == NULL) || r;
-  r = ((glPixelTransformParameteriEXT = (PFNGLPIXELTRANSFORMPARAMETERIEXTPROC)glewGetProcAddress((const GLubyte*)"glPixelTransformParameteriEXT")) == NULL) || r;
-  r = ((glPixelTransformParameterivEXT = (PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glPixelTransformParameterivEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_pixel_transform */
-#ifdef GL_EXT_pixel_transform_color_table
-#endif /* GL_EXT_pixel_transform_color_table */
-#ifdef GL_EXT_point_parameters
-static GLboolean _glewInit_GL_EXT_point_parameters (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glPointParameterfEXT = (PFNGLPOINTPARAMETERFEXTPROC)glewGetProcAddress((const GLubyte*)"glPointParameterfEXT")) == NULL) || r;
-  r = ((glPointParameterfvEXT = (PFNGLPOINTPARAMETERFVEXTPROC)glewGetProcAddress((const GLubyte*)"glPointParameterfvEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_point_parameters */
-#ifdef GL_EXT_polygon_offset
-static GLboolean _glewInit_GL_EXT_polygon_offset (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glPolygonOffsetEXT = (PFNGLPOLYGONOFFSETEXTPROC)glewGetProcAddress((const GLubyte*)"glPolygonOffsetEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_polygon_offset */
-#ifdef GL_EXT_rescale_normal
-#endif /* GL_EXT_rescale_normal */
-#ifdef GL_EXT_scene_marker
-static GLboolean _glewInit_GL_EXT_scene_marker (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBeginSceneEXT = (PFNGLBEGINSCENEEXTPROC)glewGetProcAddress((const GLubyte*)"glBeginSceneEXT")) == NULL) || r;
-  r = ((glEndSceneEXT = (PFNGLENDSCENEEXTPROC)glewGetProcAddress((const GLubyte*)"glEndSceneEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_scene_marker */
-#ifdef GL_EXT_secondary_color
-static GLboolean _glewInit_GL_EXT_secondary_color (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glSecondaryColor3bEXT = (PFNGLSECONDARYCOLOR3BEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3bEXT")) == NULL) || r;
-  r = ((glSecondaryColor3bvEXT = (PFNGLSECONDARYCOLOR3BVEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3bvEXT")) == NULL) || r;
-  r = ((glSecondaryColor3dEXT = (PFNGLSECONDARYCOLOR3DEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3dEXT")) == NULL) || r;
-  r = ((glSecondaryColor3dvEXT = (PFNGLSECONDARYCOLOR3DVEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3dvEXT")) == NULL) || r;
-  r = ((glSecondaryColor3fEXT = (PFNGLSECONDARYCOLOR3FEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3fEXT")) == NULL) || r;
-  r = ((glSecondaryColor3fvEXT = (PFNGLSECONDARYCOLOR3FVEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3fvEXT")) == NULL) || r;
-  r = ((glSecondaryColor3iEXT = (PFNGLSECONDARYCOLOR3IEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3iEXT")) == NULL) || r;
-  r = ((glSecondaryColor3ivEXT = (PFNGLSECONDARYCOLOR3IVEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3ivEXT")) == NULL) || r;
-  r = ((glSecondaryColor3sEXT = (PFNGLSECONDARYCOLOR3SEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3sEXT")) == NULL) || r;
-  r = ((glSecondaryColor3svEXT = (PFNGLSECONDARYCOLOR3SVEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3svEXT")) == NULL) || r;
-  r = ((glSecondaryColor3ubEXT = (PFNGLSECONDARYCOLOR3UBEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3ubEXT")) == NULL) || r;
-  r = ((glSecondaryColor3ubvEXT = (PFNGLSECONDARYCOLOR3UBVEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3ubvEXT")) == NULL) || r;
-  r = ((glSecondaryColor3uiEXT = (PFNGLSECONDARYCOLOR3UIEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3uiEXT")) == NULL) || r;
-  r = ((glSecondaryColor3uivEXT = (PFNGLSECONDARYCOLOR3UIVEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3uivEXT")) == NULL) || r;
-  r = ((glSecondaryColor3usEXT = (PFNGLSECONDARYCOLOR3USEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3usEXT")) == NULL) || r;
-  r = ((glSecondaryColor3usvEXT = (PFNGLSECONDARYCOLOR3USVEXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3usvEXT")) == NULL) || r;
-  r = ((glSecondaryColorPointerEXT = (PFNGLSECONDARYCOLORPOINTEREXTPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColorPointerEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_secondary_color */
-#ifdef GL_EXT_separate_specular_color
-#endif /* GL_EXT_separate_specular_color */
-#ifdef GL_EXT_shadow_funcs
-#endif /* GL_EXT_shadow_funcs */
-#ifdef GL_EXT_shared_texture_palette
-#endif /* GL_EXT_shared_texture_palette */
-#ifdef GL_EXT_stencil_clear_tag
-#endif /* GL_EXT_stencil_clear_tag */
-#ifdef GL_EXT_stencil_two_side
-static GLboolean _glewInit_GL_EXT_stencil_two_side (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glActiveStencilFaceEXT = (PFNGLACTIVESTENCILFACEEXTPROC)glewGetProcAddress((const GLubyte*)"glActiveStencilFaceEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_stencil_two_side */
-#ifdef GL_EXT_stencil_wrap
-#endif /* GL_EXT_stencil_wrap */
-#ifdef GL_EXT_subtexture
-static GLboolean _glewInit_GL_EXT_subtexture (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glTexSubImage1DEXT = (PFNGLTEXSUBIMAGE1DEXTPROC)glewGetProcAddress((const GLubyte*)"glTexSubImage1DEXT")) == NULL) || r;
-  r = ((glTexSubImage2DEXT = (PFNGLTEXSUBIMAGE2DEXTPROC)glewGetProcAddress((const GLubyte*)"glTexSubImage2DEXT")) == NULL) || r;
-  r = ((glTexSubImage3DEXT = (PFNGLTEXSUBIMAGE3DEXTPROC)glewGetProcAddress((const GLubyte*)"glTexSubImage3DEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_subtexture */
-#ifdef GL_EXT_texture
-#endif /* GL_EXT_texture */
-#ifdef GL_EXT_texture3D
-static GLboolean _glewInit_GL_EXT_texture3D (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glTexImage3DEXT = (PFNGLTEXIMAGE3DEXTPROC)glewGetProcAddress((const GLubyte*)"glTexImage3DEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_texture3D */
-#ifdef GL_EXT_texture_compression_dxt1
-#endif /* GL_EXT_texture_compression_dxt1 */
-#ifdef GL_EXT_texture_compression_s3tc
-#endif /* GL_EXT_texture_compression_s3tc */
-#ifdef GL_EXT_texture_cube_map
-#endif /* GL_EXT_texture_cube_map */
-#ifdef GL_EXT_texture_edge_clamp
-#endif /* GL_EXT_texture_edge_clamp */
-#ifdef GL_EXT_texture_env
-#endif /* GL_EXT_texture_env */
-#ifdef GL_EXT_texture_env_add
-#endif /* GL_EXT_texture_env_add */
-#ifdef GL_EXT_texture_env_combine
-#endif /* GL_EXT_texture_env_combine */
-#ifdef GL_EXT_texture_env_dot3
-#endif /* GL_EXT_texture_env_dot3 */
-#ifdef GL_EXT_texture_filter_anisotropic
-#endif /* GL_EXT_texture_filter_anisotropic */
-#ifdef GL_EXT_texture_lod_bias
-#endif /* GL_EXT_texture_lod_bias */
-#ifdef GL_EXT_texture_mirror_clamp
-#endif /* GL_EXT_texture_mirror_clamp */
-#ifdef GL_EXT_texture_object
-static GLboolean _glewInit_GL_EXT_texture_object (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glAreTexturesResidentEXT = (PFNGLARETEXTURESRESIDENTEXTPROC)glewGetProcAddress((const GLubyte*)"glAreTexturesResidentEXT")) == NULL) || r;
-  r = ((glBindTextureEXT = (PFNGLBINDTEXTUREEXTPROC)glewGetProcAddress((const GLubyte*)"glBindTextureEXT")) == NULL) || r;
-  r = ((glDeleteTexturesEXT = (PFNGLDELETETEXTURESEXTPROC)glewGetProcAddress((const GLubyte*)"glDeleteTexturesEXT")) == NULL) || r;
-  r = ((glGenTexturesEXT = (PFNGLGENTEXTURESEXTPROC)glewGetProcAddress((const GLubyte*)"glGenTexturesEXT")) == NULL) || r;
-  r = ((glIsTextureEXT = (PFNGLISTEXTUREEXTPROC)glewGetProcAddress((const GLubyte*)"glIsTextureEXT")) == NULL) || r;
-  r = ((glPrioritizeTexturesEXT = (PFNGLPRIORITIZETEXTURESEXTPROC)glewGetProcAddress((const GLubyte*)"glPrioritizeTexturesEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_texture_object */
-#ifdef GL_EXT_texture_perturb_normal
-static GLboolean _glewInit_GL_EXT_texture_perturb_normal (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glTextureNormalEXT = (PFNGLTEXTURENORMALEXTPROC)glewGetProcAddress((const GLubyte*)"glTextureNormalEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_texture_perturb_normal */
-#ifdef GL_EXT_texture_rectangle
-#endif /* GL_EXT_texture_rectangle */
-#ifdef GL_EXT_texture_sRGB
-#endif /* GL_EXT_texture_sRGB */
-#ifdef GL_EXT_vertex_array
-static GLboolean _glewInit_GL_EXT_vertex_array (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glArrayElementEXT = (PFNGLARRAYELEMENTEXTPROC)glewGetProcAddress((const GLubyte*)"glArrayElementEXT")) == NULL) || r;
-  r = ((glColorPointerEXT = (PFNGLCOLORPOINTEREXTPROC)glewGetProcAddress((const GLubyte*)"glColorPointerEXT")) == NULL) || r;
-  r = ((glDrawArraysEXT = (PFNGLDRAWARRAYSEXTPROC)glewGetProcAddress((const GLubyte*)"glDrawArraysEXT")) == NULL) || r;
-  r = ((glEdgeFlagPointerEXT = (PFNGLEDGEFLAGPOINTEREXTPROC)glewGetProcAddress((const GLubyte*)"glEdgeFlagPointerEXT")) == NULL) || r;
-  r = ((glGetPointervEXT = (PFNGLGETPOINTERVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetPointervEXT")) == NULL) || r;
-  r = ((glIndexPointerEXT = (PFNGLINDEXPOINTEREXTPROC)glewGetProcAddress((const GLubyte*)"glIndexPointerEXT")) == NULL) || r;
-  r = ((glNormalPointerEXT = (PFNGLNORMALPOINTEREXTPROC)glewGetProcAddress((const GLubyte*)"glNormalPointerEXT")) == NULL) || r;
-  r = ((glTexCoordPointerEXT = (PFNGLTEXCOORDPOINTEREXTPROC)glewGetProcAddress((const GLubyte*)"glTexCoordPointerEXT")) == NULL) || r;
-  r = ((glVertexPointerEXT = (PFNGLVERTEXPOINTEREXTPROC)glewGetProcAddress((const GLubyte*)"glVertexPointerEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_vertex_array */
-#ifdef GL_EXT_vertex_shader
-static GLboolean _glewInit_GL_EXT_vertex_shader (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBeginVertexShaderEXT = (PFNGLBEGINVERTEXSHADEREXTPROC)glewGetProcAddress((const GLubyte*)"glBeginVertexShaderEXT")) == NULL) || r;
-  r = ((glBindLightParameterEXT = (PFNGLBINDLIGHTPARAMETEREXTPROC)glewGetProcAddress((const GLubyte*)"glBindLightParameterEXT")) == NULL) || r;
-  r = ((glBindMaterialParameterEXT = (PFNGLBINDMATERIALPARAMETEREXTPROC)glewGetProcAddress((const GLubyte*)"glBindMaterialParameterEXT")) == NULL) || r;
-  r = ((glBindParameterEXT = (PFNGLBINDPARAMETEREXTPROC)glewGetProcAddress((const GLubyte*)"glBindParameterEXT")) == NULL) || r;
-  r = ((glBindTexGenParameterEXT = (PFNGLBINDTEXGENPARAMETEREXTPROC)glewGetProcAddress((const GLubyte*)"glBindTexGenParameterEXT")) == NULL) || r;
-  r = ((glBindTextureUnitParameterEXT = (PFNGLBINDTEXTUREUNITPARAMETEREXTPROC)glewGetProcAddress((const GLubyte*)"glBindTextureUnitParameterEXT")) == NULL) || r;
-  r = ((glBindVertexShaderEXT = (PFNGLBINDVERTEXSHADEREXTPROC)glewGetProcAddress((const GLubyte*)"glBindVertexShaderEXT")) == NULL) || r;
-  r = ((glDeleteVertexShaderEXT = (PFNGLDELETEVERTEXSHADEREXTPROC)glewGetProcAddress((const GLubyte*)"glDeleteVertexShaderEXT")) == NULL) || r;
-  r = ((glDisableVariantClientStateEXT = (PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC)glewGetProcAddress((const GLubyte*)"glDisableVariantClientStateEXT")) == NULL) || r;
-  r = ((glEnableVariantClientStateEXT = (PFNGLENABLEVARIANTCLIENTSTATEEXTPROC)glewGetProcAddress((const GLubyte*)"glEnableVariantClientStateEXT")) == NULL) || r;
-  r = ((glEndVertexShaderEXT = (PFNGLENDVERTEXSHADEREXTPROC)glewGetProcAddress((const GLubyte*)"glEndVertexShaderEXT")) == NULL) || r;
-  r = ((glExtractComponentEXT = (PFNGLEXTRACTCOMPONENTEXTPROC)glewGetProcAddress((const GLubyte*)"glExtractComponentEXT")) == NULL) || r;
-  r = ((glGenSymbolsEXT = (PFNGLGENSYMBOLSEXTPROC)glewGetProcAddress((const GLubyte*)"glGenSymbolsEXT")) == NULL) || r;
-  r = ((glGenVertexShadersEXT = (PFNGLGENVERTEXSHADERSEXTPROC)glewGetProcAddress((const GLubyte*)"glGenVertexShadersEXT")) == NULL) || r;
-  r = ((glGetInvariantBooleanvEXT = (PFNGLGETINVARIANTBOOLEANVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetInvariantBooleanvEXT")) == NULL) || r;
-  r = ((glGetInvariantFloatvEXT = (PFNGLGETINVARIANTFLOATVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetInvariantFloatvEXT")) == NULL) || r;
-  r = ((glGetInvariantIntegervEXT = (PFNGLGETINVARIANTINTEGERVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetInvariantIntegervEXT")) == NULL) || r;
-  r = ((glGetLocalConstantBooleanvEXT = (PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetLocalConstantBooleanvEXT")) == NULL) || r;
-  r = ((glGetLocalConstantFloatvEXT = (PFNGLGETLOCALCONSTANTFLOATVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetLocalConstantFloatvEXT")) == NULL) || r;
-  r = ((glGetLocalConstantIntegervEXT = (PFNGLGETLOCALCONSTANTINTEGERVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetLocalConstantIntegervEXT")) == NULL) || r;
-  r = ((glGetVariantBooleanvEXT = (PFNGLGETVARIANTBOOLEANVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetVariantBooleanvEXT")) == NULL) || r;
-  r = ((glGetVariantFloatvEXT = (PFNGLGETVARIANTFLOATVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetVariantFloatvEXT")) == NULL) || r;
-  r = ((glGetVariantIntegervEXT = (PFNGLGETVARIANTINTEGERVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetVariantIntegervEXT")) == NULL) || r;
-  r = ((glGetVariantPointervEXT = (PFNGLGETVARIANTPOINTERVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetVariantPointervEXT")) == NULL) || r;
-  r = ((glInsertComponentEXT = (PFNGLINSERTCOMPONENTEXTPROC)glewGetProcAddress((const GLubyte*)"glInsertComponentEXT")) == NULL) || r;
-  r = ((glIsVariantEnabledEXT = (PFNGLISVARIANTENABLEDEXTPROC)glewGetProcAddress((const GLubyte*)"glIsVariantEnabledEXT")) == NULL) || r;
-  r = ((glSetInvariantEXT = (PFNGLSETINVARIANTEXTPROC)glewGetProcAddress((const GLubyte*)"glSetInvariantEXT")) == NULL) || r;
-  r = ((glSetLocalConstantEXT = (PFNGLSETLOCALCONSTANTEXTPROC)glewGetProcAddress((const GLubyte*)"glSetLocalConstantEXT")) == NULL) || r;
-  r = ((glShaderOp1EXT = (PFNGLSHADEROP1EXTPROC)glewGetProcAddress((const GLubyte*)"glShaderOp1EXT")) == NULL) || r;
-  r = ((glShaderOp2EXT = (PFNGLSHADEROP2EXTPROC)glewGetProcAddress((const GLubyte*)"glShaderOp2EXT")) == NULL) || r;
-  r = ((glShaderOp3EXT = (PFNGLSHADEROP3EXTPROC)glewGetProcAddress((const GLubyte*)"glShaderOp3EXT")) == NULL) || r;
-  r = ((glSwizzleEXT = (PFNGLSWIZZLEEXTPROC)glewGetProcAddress((const GLubyte*)"glSwizzleEXT")) == NULL) || r;
-  r = ((glVariantPointerEXT = (PFNGLVARIANTPOINTEREXTPROC)glewGetProcAddress((const GLubyte*)"glVariantPointerEXT")) == NULL) || r;
-  r = ((glVariantbvEXT = (PFNGLVARIANTBVEXTPROC)glewGetProcAddress((const GLubyte*)"glVariantbvEXT")) == NULL) || r;
-  r = ((glVariantdvEXT = (PFNGLVARIANTDVEXTPROC)glewGetProcAddress((const GLubyte*)"glVariantdvEXT")) == NULL) || r;
-  r = ((glVariantfvEXT = (PFNGLVARIANTFVEXTPROC)glewGetProcAddress((const GLubyte*)"glVariantfvEXT")) == NULL) || r;
-  r = ((glVariantivEXT = (PFNGLVARIANTIVEXTPROC)glewGetProcAddress((const GLubyte*)"glVariantivEXT")) == NULL) || r;
-  r = ((glVariantsvEXT = (PFNGLVARIANTSVEXTPROC)glewGetProcAddress((const GLubyte*)"glVariantsvEXT")) == NULL) || r;
-  r = ((glVariantubvEXT = (PFNGLVARIANTUBVEXTPROC)glewGetProcAddress((const GLubyte*)"glVariantubvEXT")) == NULL) || r;
-  r = ((glVariantuivEXT = (PFNGLVARIANTUIVEXTPROC)glewGetProcAddress((const GLubyte*)"glVariantuivEXT")) == NULL) || r;
-  r = ((glVariantusvEXT = (PFNGLVARIANTUSVEXTPROC)glewGetProcAddress((const GLubyte*)"glVariantusvEXT")) == NULL) || r;
-  r = ((glWriteMaskEXT = (PFNGLWRITEMASKEXTPROC)glewGetProcAddress((const GLubyte*)"glWriteMaskEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_vertex_shader */
-#ifdef GL_EXT_vertex_weighting
-static GLboolean _glewInit_GL_EXT_vertex_weighting (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glVertexWeightPointerEXT = (PFNGLVERTEXWEIGHTPOINTEREXTPROC)glewGetProcAddress((const GLubyte*)"glVertexWeightPointerEXT")) == NULL) || r;
-  r = ((glVertexWeightfEXT = (PFNGLVERTEXWEIGHTFEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexWeightfEXT")) == NULL) || r;
-  r = ((glVertexWeightfvEXT = (PFNGLVERTEXWEIGHTFVEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexWeightfvEXT")) == NULL) || r;
-  return r;
-#endif /* GL_EXT_vertex_weighting */
-#ifdef GL_GREMEDY_string_marker
-static GLboolean _glewInit_GL_GREMEDY_string_marker (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glStringMarkerGREMEDY = (PFNGLSTRINGMARKERGREMEDYPROC)glewGetProcAddress((const GLubyte*)"glStringMarkerGREMEDY")) == NULL) || r;
-  return r;
-#endif /* GL_GREMEDY_string_marker */
-#ifdef GL_HP_convolution_border_modes
-#endif /* GL_HP_convolution_border_modes */
-#ifdef GL_HP_image_transform
-static GLboolean _glewInit_GL_HP_image_transform (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glGetImageTransformParameterfvHP = (PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC)glewGetProcAddress((const GLubyte*)"glGetImageTransformParameterfvHP")) == NULL) || r;
-  r = ((glGetImageTransformParameterivHP = (PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC)glewGetProcAddress((const GLubyte*)"glGetImageTransformParameterivHP")) == NULL) || r;
-  r = ((glImageTransformParameterfHP = (PFNGLIMAGETRANSFORMPARAMETERFHPPROC)glewGetProcAddress((const GLubyte*)"glImageTransformParameterfHP")) == NULL) || r;
-  r = ((glImageTransformParameterfvHP = (PFNGLIMAGETRANSFORMPARAMETERFVHPPROC)glewGetProcAddress((const GLubyte*)"glImageTransformParameterfvHP")) == NULL) || r;
-  r = ((glImageTransformParameteriHP = (PFNGLIMAGETRANSFORMPARAMETERIHPPROC)glewGetProcAddress((const GLubyte*)"glImageTransformParameteriHP")) == NULL) || r;
-  r = ((glImageTransformParameterivHP = (PFNGLIMAGETRANSFORMPARAMETERIVHPPROC)glewGetProcAddress((const GLubyte*)"glImageTransformParameterivHP")) == NULL) || r;
-  return r;
-#endif /* GL_HP_image_transform */
-#ifdef GL_HP_occlusion_test
-#endif /* GL_HP_occlusion_test */
-#ifdef GL_HP_texture_lighting
-#endif /* GL_HP_texture_lighting */
-#ifdef GL_IBM_cull_vertex
-#endif /* GL_IBM_cull_vertex */
-#ifdef GL_IBM_multimode_draw_arrays
-static GLboolean _glewInit_GL_IBM_multimode_draw_arrays (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glMultiModeDrawArraysIBM = (PFNGLMULTIMODEDRAWARRAYSIBMPROC)glewGetProcAddress((const GLubyte*)"glMultiModeDrawArraysIBM")) == NULL) || r;
-  r = ((glMultiModeDrawElementsIBM = (PFNGLMULTIMODEDRAWELEMENTSIBMPROC)glewGetProcAddress((const GLubyte*)"glMultiModeDrawElementsIBM")) == NULL) || r;
-  return r;
-#endif /* GL_IBM_multimode_draw_arrays */
-#ifdef GL_IBM_rasterpos_clip
-#endif /* GL_IBM_rasterpos_clip */
-#ifdef GL_IBM_static_data
-#endif /* GL_IBM_static_data */
-#ifdef GL_IBM_texture_mirrored_repeat
-#endif /* GL_IBM_texture_mirrored_repeat */
-#ifdef GL_IBM_vertex_array_lists
-static GLboolean _glewInit_GL_IBM_vertex_array_lists (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glColorPointerListIBM = (PFNGLCOLORPOINTERLISTIBMPROC)glewGetProcAddress((const GLubyte*)"glColorPointerListIBM")) == NULL) || r;
-  r = ((glEdgeFlagPointerListIBM = (PFNGLEDGEFLAGPOINTERLISTIBMPROC)glewGetProcAddress((const GLubyte*)"glEdgeFlagPointerListIBM")) == NULL) || r;
-  r = ((glFogCoordPointerListIBM = (PFNGLFOGCOORDPOINTERLISTIBMPROC)glewGetProcAddress((const GLubyte*)"glFogCoordPointerListIBM")) == NULL) || r;
-  r = ((glIndexPointerListIBM = (PFNGLINDEXPOINTERLISTIBMPROC)glewGetProcAddress((const GLubyte*)"glIndexPointerListIBM")) == NULL) || r;
-  r = ((glNormalPointerListIBM = (PFNGLNORMALPOINTERLISTIBMPROC)glewGetProcAddress((const GLubyte*)"glNormalPointerListIBM")) == NULL) || r;
-  r = ((glSecondaryColorPointerListIBM = (PFNGLSECONDARYCOLORPOINTERLISTIBMPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColorPointerListIBM")) == NULL) || r;
-  r = ((glTexCoordPointerListIBM = (PFNGLTEXCOORDPOINTERLISTIBMPROC)glewGetProcAddress((const GLubyte*)"glTexCoordPointerListIBM")) == NULL) || r;
-  r = ((glVertexPointerListIBM = (PFNGLVERTEXPOINTERLISTIBMPROC)glewGetProcAddress((const GLubyte*)"glVertexPointerListIBM")) == NULL) || r;
-  return r;
-#endif /* GL_IBM_vertex_array_lists */
-#ifdef GL_INGR_color_clamp
-#endif /* GL_INGR_color_clamp */
-#ifdef GL_INGR_interlace_read
-#endif /* GL_INGR_interlace_read */
-#ifdef GL_INTEL_parallel_arrays
-static GLboolean _glewInit_GL_INTEL_parallel_arrays (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glColorPointervINTEL = (PFNGLCOLORPOINTERVINTELPROC)glewGetProcAddress((const GLubyte*)"glColorPointervINTEL")) == NULL) || r;
-  r = ((glNormalPointervINTEL = (PFNGLNORMALPOINTERVINTELPROC)glewGetProcAddress((const GLubyte*)"glNormalPointervINTEL")) == NULL) || r;
-  r = ((glTexCoordPointervINTEL = (PFNGLTEXCOORDPOINTERVINTELPROC)glewGetProcAddress((const GLubyte*)"glTexCoordPointervINTEL")) == NULL) || r;
-  r = ((glVertexPointervINTEL = (PFNGLVERTEXPOINTERVINTELPROC)glewGetProcAddress((const GLubyte*)"glVertexPointervINTEL")) == NULL) || r;
-  return r;
-#endif /* GL_INTEL_parallel_arrays */
-#ifdef GL_INTEL_texture_scissor
-static GLboolean _glewInit_GL_INTEL_texture_scissor (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glTexScissorFuncINTEL = (PFNGLTEXSCISSORFUNCINTELPROC)glewGetProcAddress((const GLubyte*)"glTexScissorFuncINTEL")) == NULL) || r;
-  r = ((glTexScissorINTEL = (PFNGLTEXSCISSORINTELPROC)glewGetProcAddress((const GLubyte*)"glTexScissorINTEL")) == NULL) || r;
-  return r;
-#endif /* GL_INTEL_texture_scissor */
-#ifdef GL_KTX_buffer_region
-static GLboolean _glewInit_GL_KTX_buffer_region (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBufferRegionEnabledEXT = (PFNGLBUFFERREGIONENABLEDEXTPROC)glewGetProcAddress((const GLubyte*)"glBufferRegionEnabledEXT")) == NULL) || r;
-  r = ((glDeleteBufferRegionEXT = (PFNGLDELETEBUFFERREGIONEXTPROC)glewGetProcAddress((const GLubyte*)"glDeleteBufferRegionEXT")) == NULL) || r;
-  r = ((glDrawBufferRegionEXT = (PFNGLDRAWBUFFERREGIONEXTPROC)glewGetProcAddress((const GLubyte*)"glDrawBufferRegionEXT")) == NULL) || r;
-  r = ((glNewBufferRegionEXT = (PFNGLNEWBUFFERREGIONEXTPROC)glewGetProcAddress((const GLubyte*)"glNewBufferRegionEXT")) == NULL) || r;
-  r = ((glReadBufferRegionEXT = (PFNGLREADBUFFERREGIONEXTPROC)glewGetProcAddress((const GLubyte*)"glReadBufferRegionEXT")) == NULL) || r;
-  return r;
-#endif /* GL_KTX_buffer_region */
-#ifdef GL_MESAX_texture_stack
-#endif /* GL_MESAX_texture_stack */
-#ifdef GL_MESA_pack_invert
-#endif /* GL_MESA_pack_invert */
-#ifdef GL_MESA_resize_buffers
-static GLboolean _glewInit_GL_MESA_resize_buffers (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glResizeBuffersMESA = (PFNGLRESIZEBUFFERSMESAPROC)glewGetProcAddress((const GLubyte*)"glResizeBuffersMESA")) == NULL) || r;
-  return r;
-#endif /* GL_MESA_resize_buffers */
-#ifdef GL_MESA_window_pos
-static GLboolean _glewInit_GL_MESA_window_pos (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glWindowPos2dMESA = (PFNGLWINDOWPOS2DMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2dMESA")) == NULL) || r;
-  r = ((glWindowPos2dvMESA = (PFNGLWINDOWPOS2DVMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2dvMESA")) == NULL) || r;
-  r = ((glWindowPos2fMESA = (PFNGLWINDOWPOS2FMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2fMESA")) == NULL) || r;
-  r = ((glWindowPos2fvMESA = (PFNGLWINDOWPOS2FVMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2fvMESA")) == NULL) || r;
-  r = ((glWindowPos2iMESA = (PFNGLWINDOWPOS2IMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2iMESA")) == NULL) || r;
-  r = ((glWindowPos2ivMESA = (PFNGLWINDOWPOS2IVMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2ivMESA")) == NULL) || r;
-  r = ((glWindowPos2sMESA = (PFNGLWINDOWPOS2SMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2sMESA")) == NULL) || r;
-  r = ((glWindowPos2svMESA = (PFNGLWINDOWPOS2SVMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos2svMESA")) == NULL) || r;
-  r = ((glWindowPos3dMESA = (PFNGLWINDOWPOS3DMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3dMESA")) == NULL) || r;
-  r = ((glWindowPos3dvMESA = (PFNGLWINDOWPOS3DVMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3dvMESA")) == NULL) || r;
-  r = ((glWindowPos3fMESA = (PFNGLWINDOWPOS3FMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3fMESA")) == NULL) || r;
-  r = ((glWindowPos3fvMESA = (PFNGLWINDOWPOS3FVMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3fvMESA")) == NULL) || r;
-  r = ((glWindowPos3iMESA = (PFNGLWINDOWPOS3IMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3iMESA")) == NULL) || r;
-  r = ((glWindowPos3ivMESA = (PFNGLWINDOWPOS3IVMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3ivMESA")) == NULL) || r;
-  r = ((glWindowPos3sMESA = (PFNGLWINDOWPOS3SMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3sMESA")) == NULL) || r;
-  r = ((glWindowPos3svMESA = (PFNGLWINDOWPOS3SVMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos3svMESA")) == NULL) || r;
-  r = ((glWindowPos4dMESA = (PFNGLWINDOWPOS4DMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos4dMESA")) == NULL) || r;
-  r = ((glWindowPos4dvMESA = (PFNGLWINDOWPOS4DVMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos4dvMESA")) == NULL) || r;
-  r = ((glWindowPos4fMESA = (PFNGLWINDOWPOS4FMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos4fMESA")) == NULL) || r;
-  r = ((glWindowPos4fvMESA = (PFNGLWINDOWPOS4FVMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos4fvMESA")) == NULL) || r;
-  r = ((glWindowPos4iMESA = (PFNGLWINDOWPOS4IMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos4iMESA")) == NULL) || r;
-  r = ((glWindowPos4ivMESA = (PFNGLWINDOWPOS4IVMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos4ivMESA")) == NULL) || r;
-  r = ((glWindowPos4sMESA = (PFNGLWINDOWPOS4SMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos4sMESA")) == NULL) || r;
-  r = ((glWindowPos4svMESA = (PFNGLWINDOWPOS4SVMESAPROC)glewGetProcAddress((const GLubyte*)"glWindowPos4svMESA")) == NULL) || r;
-  return r;
-#endif /* GL_MESA_window_pos */
-#ifdef GL_MESA_ycbcr_texture
-#endif /* GL_MESA_ycbcr_texture */
-#ifdef GL_NV_blend_square
-#endif /* GL_NV_blend_square */
-#ifdef GL_NV_copy_depth_to_color
-#endif /* GL_NV_copy_depth_to_color */
-#ifdef GL_NV_depth_clamp
-#endif /* GL_NV_depth_clamp */
-#ifdef GL_NV_evaluators
-static GLboolean _glewInit_GL_NV_evaluators (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glEvalMapsNV = (PFNGLEVALMAPSNVPROC)glewGetProcAddress((const GLubyte*)"glEvalMapsNV")) == NULL) || r;
-  r = ((glGetMapAttribParameterfvNV = (PFNGLGETMAPATTRIBPARAMETERFVNVPROC)glewGetProcAddress((const GLubyte*)"glGetMapAttribParameterfvNV")) == NULL) || r;
-  r = ((glGetMapAttribParameterivNV = (PFNGLGETMAPATTRIBPARAMETERIVNVPROC)glewGetProcAddress((const GLubyte*)"glGetMapAttribParameterivNV")) == NULL) || r;
-  r = ((glGetMapControlPointsNV = (PFNGLGETMAPCONTROLPOINTSNVPROC)glewGetProcAddress((const GLubyte*)"glGetMapControlPointsNV")) == NULL) || r;
-  r = ((glGetMapParameterfvNV = (PFNGLGETMAPPARAMETERFVNVPROC)glewGetProcAddress((const GLubyte*)"glGetMapParameterfvNV")) == NULL) || r;
-  r = ((glGetMapParameterivNV = (PFNGLGETMAPPARAMETERIVNVPROC)glewGetProcAddress((const GLubyte*)"glGetMapParameterivNV")) == NULL) || r;
-  r = ((glMapControlPointsNV = (PFNGLMAPCONTROLPOINTSNVPROC)glewGetProcAddress((const GLubyte*)"glMapControlPointsNV")) == NULL) || r;
-  r = ((glMapParameterfvNV = (PFNGLMAPPARAMETERFVNVPROC)glewGetProcAddress((const GLubyte*)"glMapParameterfvNV")) == NULL) || r;
-  r = ((glMapParameterivNV = (PFNGLMAPPARAMETERIVNVPROC)glewGetProcAddress((const GLubyte*)"glMapParameterivNV")) == NULL) || r;
-  return r;
-#endif /* GL_NV_evaluators */
-#ifdef GL_NV_fence
-static GLboolean _glewInit_GL_NV_fence (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glDeleteFencesNV = (PFNGLDELETEFENCESNVPROC)glewGetProcAddress((const GLubyte*)"glDeleteFencesNV")) == NULL) || r;
-  r = ((glFinishFenceNV = (PFNGLFINISHFENCENVPROC)glewGetProcAddress((const GLubyte*)"glFinishFenceNV")) == NULL) || r;
-  r = ((glGenFencesNV = (PFNGLGENFENCESNVPROC)glewGetProcAddress((const GLubyte*)"glGenFencesNV")) == NULL) || r;
-  r = ((glGetFenceivNV = (PFNGLGETFENCEIVNVPROC)glewGetProcAddress((const GLubyte*)"glGetFenceivNV")) == NULL) || r;
-  r = ((glIsFenceNV = (PFNGLISFENCENVPROC)glewGetProcAddress((const GLubyte*)"glIsFenceNV")) == NULL) || r;
-  r = ((glSetFenceNV = (PFNGLSETFENCENVPROC)glewGetProcAddress((const GLubyte*)"glSetFenceNV")) == NULL) || r;
-  r = ((glTestFenceNV = (PFNGLTESTFENCENVPROC)glewGetProcAddress((const GLubyte*)"glTestFenceNV")) == NULL) || r;
-  return r;
-#endif /* GL_NV_fence */
-#ifdef GL_NV_float_buffer
-#endif /* GL_NV_float_buffer */
-#ifdef GL_NV_fog_distance
-#endif /* GL_NV_fog_distance */
-#ifdef GL_NV_fragment_program
-static GLboolean _glewInit_GL_NV_fragment_program (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glGetProgramNamedParameterdvNV = (PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC)glewGetProcAddress((const GLubyte*)"glGetProgramNamedParameterdvNV")) == NULL) || r;
-  r = ((glGetProgramNamedParameterfvNV = (PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC)glewGetProcAddress((const GLubyte*)"glGetProgramNamedParameterfvNV")) == NULL) || r;
-  r = ((glProgramNamedParameter4dNV = (PFNGLPROGRAMNAMEDPARAMETER4DNVPROC)glewGetProcAddress((const GLubyte*)"glProgramNamedParameter4dNV")) == NULL) || r;
-  r = ((glProgramNamedParameter4dvNV = (PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC)glewGetProcAddress((const GLubyte*)"glProgramNamedParameter4dvNV")) == NULL) || r;
-  r = ((glProgramNamedParameter4fNV = (PFNGLPROGRAMNAMEDPARAMETER4FNVPROC)glewGetProcAddress((const GLubyte*)"glProgramNamedParameter4fNV")) == NULL) || r;
-  r = ((glProgramNamedParameter4fvNV = (PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC)glewGetProcAddress((const GLubyte*)"glProgramNamedParameter4fvNV")) == NULL) || r;
-  return r;
-#endif /* GL_NV_fragment_program */
-#ifdef GL_NV_fragment_program2
-#endif /* GL_NV_fragment_program2 */
-#ifdef GL_NV_fragment_program_option
-#endif /* GL_NV_fragment_program_option */
-#ifdef GL_NV_half_float
-static GLboolean _glewInit_GL_NV_half_float (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glColor3hNV = (PFNGLCOLOR3HNVPROC)glewGetProcAddress((const GLubyte*)"glColor3hNV")) == NULL) || r;
-  r = ((glColor3hvNV = (PFNGLCOLOR3HVNVPROC)glewGetProcAddress((const GLubyte*)"glColor3hvNV")) == NULL) || r;
-  r = ((glColor4hNV = (PFNGLCOLOR4HNVPROC)glewGetProcAddress((const GLubyte*)"glColor4hNV")) == NULL) || r;
-  r = ((glColor4hvNV = (PFNGLCOLOR4HVNVPROC)glewGetProcAddress((const GLubyte*)"glColor4hvNV")) == NULL) || r;
-  r = ((glFogCoordhNV = (PFNGLFOGCOORDHNVPROC)glewGetProcAddress((const GLubyte*)"glFogCoordhNV")) == NULL) || r;
-  r = ((glFogCoordhvNV = (PFNGLFOGCOORDHVNVPROC)glewGetProcAddress((const GLubyte*)"glFogCoordhvNV")) == NULL) || r;
-  r = ((glMultiTexCoord1hNV = (PFNGLMULTITEXCOORD1HNVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1hNV")) == NULL) || r;
-  r = ((glMultiTexCoord1hvNV = (PFNGLMULTITEXCOORD1HVNVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord1hvNV")) == NULL) || r;
-  r = ((glMultiTexCoord2hNV = (PFNGLMULTITEXCOORD2HNVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2hNV")) == NULL) || r;
-  r = ((glMultiTexCoord2hvNV = (PFNGLMULTITEXCOORD2HVNVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord2hvNV")) == NULL) || r;
-  r = ((glMultiTexCoord3hNV = (PFNGLMULTITEXCOORD3HNVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3hNV")) == NULL) || r;
-  r = ((glMultiTexCoord3hvNV = (PFNGLMULTITEXCOORD3HVNVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord3hvNV")) == NULL) || r;
-  r = ((glMultiTexCoord4hNV = (PFNGLMULTITEXCOORD4HNVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4hNV")) == NULL) || r;
-  r = ((glMultiTexCoord4hvNV = (PFNGLMULTITEXCOORD4HVNVPROC)glewGetProcAddress((const GLubyte*)"glMultiTexCoord4hvNV")) == NULL) || r;
-  r = ((glNormal3hNV = (PFNGLNORMAL3HNVPROC)glewGetProcAddress((const GLubyte*)"glNormal3hNV")) == NULL) || r;
-  r = ((glNormal3hvNV = (PFNGLNORMAL3HVNVPROC)glewGetProcAddress((const GLubyte*)"glNormal3hvNV")) == NULL) || r;
-  r = ((glSecondaryColor3hNV = (PFNGLSECONDARYCOLOR3HNVPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3hNV")) == NULL) || r;
-  r = ((glSecondaryColor3hvNV = (PFNGLSECONDARYCOLOR3HVNVPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColor3hvNV")) == NULL) || r;
-  r = ((glTexCoord1hNV = (PFNGLTEXCOORD1HNVPROC)glewGetProcAddress((const GLubyte*)"glTexCoord1hNV")) == NULL) || r;
-  r = ((glTexCoord1hvNV = (PFNGLTEXCOORD1HVNVPROC)glewGetProcAddress((const GLubyte*)"glTexCoord1hvNV")) == NULL) || r;
-  r = ((glTexCoord2hNV = (PFNGLTEXCOORD2HNVPROC)glewGetProcAddress((const GLubyte*)"glTexCoord2hNV")) == NULL) || r;
-  r = ((glTexCoord2hvNV = (PFNGLTEXCOORD2HVNVPROC)glewGetProcAddress((const GLubyte*)"glTexCoord2hvNV")) == NULL) || r;
-  r = ((glTexCoord3hNV = (PFNGLTEXCOORD3HNVPROC)glewGetProcAddress((const GLubyte*)"glTexCoord3hNV")) == NULL) || r;
-  r = ((glTexCoord3hvNV = (PFNGLTEXCOORD3HVNVPROC)glewGetProcAddress((const GLubyte*)"glTexCoord3hvNV")) == NULL) || r;
-  r = ((glTexCoord4hNV = (PFNGLTEXCOORD4HNVPROC)glewGetProcAddress((const GLubyte*)"glTexCoord4hNV")) == NULL) || r;
-  r = ((glTexCoord4hvNV = (PFNGLTEXCOORD4HVNVPROC)glewGetProcAddress((const GLubyte*)"glTexCoord4hvNV")) == NULL) || r;
-  r = ((glVertex2hNV = (PFNGLVERTEX2HNVPROC)glewGetProcAddress((const GLubyte*)"glVertex2hNV")) == NULL) || r;
-  r = ((glVertex2hvNV = (PFNGLVERTEX2HVNVPROC)glewGetProcAddress((const GLubyte*)"glVertex2hvNV")) == NULL) || r;
-  r = ((glVertex3hNV = (PFNGLVERTEX3HNVPROC)glewGetProcAddress((const GLubyte*)"glVertex3hNV")) == NULL) || r;
-  r = ((glVertex3hvNV = (PFNGLVERTEX3HVNVPROC)glewGetProcAddress((const GLubyte*)"glVertex3hvNV")) == NULL) || r;
-  r = ((glVertex4hNV = (PFNGLVERTEX4HNVPROC)glewGetProcAddress((const GLubyte*)"glVertex4hNV")) == NULL) || r;
-  r = ((glVertex4hvNV = (PFNGLVERTEX4HVNVPROC)glewGetProcAddress((const GLubyte*)"glVertex4hvNV")) == NULL) || r;
-  r = ((glVertexAttrib1hNV = (PFNGLVERTEXATTRIB1HNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1hNV")) == NULL) || r;
-  r = ((glVertexAttrib1hvNV = (PFNGLVERTEXATTRIB1HVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1hvNV")) == NULL) || r;
-  r = ((glVertexAttrib2hNV = (PFNGLVERTEXATTRIB2HNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2hNV")) == NULL) || r;
-  r = ((glVertexAttrib2hvNV = (PFNGLVERTEXATTRIB2HVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2hvNV")) == NULL) || r;
-  r = ((glVertexAttrib3hNV = (PFNGLVERTEXATTRIB3HNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3hNV")) == NULL) || r;
-  r = ((glVertexAttrib3hvNV = (PFNGLVERTEXATTRIB3HVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3hvNV")) == NULL) || r;
-  r = ((glVertexAttrib4hNV = (PFNGLVERTEXATTRIB4HNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4hNV")) == NULL) || r;
-  r = ((glVertexAttrib4hvNV = (PFNGLVERTEXATTRIB4HVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4hvNV")) == NULL) || r;
-  r = ((glVertexAttribs1hvNV = (PFNGLVERTEXATTRIBS1HVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs1hvNV")) == NULL) || r;
-  r = ((glVertexAttribs2hvNV = (PFNGLVERTEXATTRIBS2HVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs2hvNV")) == NULL) || r;
-  r = ((glVertexAttribs3hvNV = (PFNGLVERTEXATTRIBS3HVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs3hvNV")) == NULL) || r;
-  r = ((glVertexAttribs4hvNV = (PFNGLVERTEXATTRIBS4HVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs4hvNV")) == NULL) || r;
-  r = ((glVertexWeighthNV = (PFNGLVERTEXWEIGHTHNVPROC)glewGetProcAddress((const GLubyte*)"glVertexWeighthNV")) == NULL) || r;
-  r = ((glVertexWeighthvNV = (PFNGLVERTEXWEIGHTHVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexWeighthvNV")) == NULL) || r;
-  return r;
-#endif /* GL_NV_half_float */
-#ifdef GL_NV_light_max_exponent
-#endif /* GL_NV_light_max_exponent */
-#ifdef GL_NV_multisample_filter_hint
-#endif /* GL_NV_multisample_filter_hint */
-#ifdef GL_NV_occlusion_query
-static GLboolean _glewInit_GL_NV_occlusion_query (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glBeginOcclusionQueryNV = (PFNGLBEGINOCCLUSIONQUERYNVPROC)glewGetProcAddress((const GLubyte*)"glBeginOcclusionQueryNV")) == NULL) || r;
-  r = ((glDeleteOcclusionQueriesNV = (PFNGLDELETEOCCLUSIONQUERIESNVPROC)glewGetProcAddress((const GLubyte*)"glDeleteOcclusionQueriesNV")) == NULL) || r;
-  r = ((glEndOcclusionQueryNV = (PFNGLENDOCCLUSIONQUERYNVPROC)glewGetProcAddress((const GLubyte*)"glEndOcclusionQueryNV")) == NULL) || r;
-  r = ((glGenOcclusionQueriesNV = (PFNGLGENOCCLUSIONQUERIESNVPROC)glewGetProcAddress((const GLubyte*)"glGenOcclusionQueriesNV")) == NULL) || r;
-  r = ((glGetOcclusionQueryivNV = (PFNGLGETOCCLUSIONQUERYIVNVPROC)glewGetProcAddress((const GLubyte*)"glGetOcclusionQueryivNV")) == NULL) || r;
-  r = ((glGetOcclusionQueryuivNV = (PFNGLGETOCCLUSIONQUERYUIVNVPROC)glewGetProcAddress((const GLubyte*)"glGetOcclusionQueryuivNV")) == NULL) || r;
-  r = ((glIsOcclusionQueryNV = (PFNGLISOCCLUSIONQUERYNVPROC)glewGetProcAddress((const GLubyte*)"glIsOcclusionQueryNV")) == NULL) || r;
-  return r;
-#endif /* GL_NV_occlusion_query */
-#ifdef GL_NV_packed_depth_stencil
-#endif /* GL_NV_packed_depth_stencil */
-#ifdef GL_NV_pixel_data_range
-static GLboolean _glewInit_GL_NV_pixel_data_range (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glFlushPixelDataRangeNV = (PFNGLFLUSHPIXELDATARANGENVPROC)glewGetProcAddress((const GLubyte*)"glFlushPixelDataRangeNV")) == NULL) || r;
-  r = ((glPixelDataRangeNV = (PFNGLPIXELDATARANGENVPROC)glewGetProcAddress((const GLubyte*)"glPixelDataRangeNV")) == NULL) || r;
-  return r;
-#endif /* GL_NV_pixel_data_range */
-#ifdef GL_NV_point_sprite
-static GLboolean _glewInit_GL_NV_point_sprite (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glPointParameteriNV = (PFNGLPOINTPARAMETERINVPROC)glewGetProcAddress((const GLubyte*)"glPointParameteriNV")) == NULL) || r;
-  r = ((glPointParameterivNV = (PFNGLPOINTPARAMETERIVNVPROC)glewGetProcAddress((const GLubyte*)"glPointParameterivNV")) == NULL) || r;
-  return r;
-#endif /* GL_NV_point_sprite */
-#ifdef GL_NV_primitive_restart
-static GLboolean _glewInit_GL_NV_primitive_restart (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glPrimitiveRestartIndexNV = (PFNGLPRIMITIVERESTARTINDEXNVPROC)glewGetProcAddress((const GLubyte*)"glPrimitiveRestartIndexNV")) == NULL) || r;
-  r = ((glPrimitiveRestartNV = (PFNGLPRIMITIVERESTARTNVPROC)glewGetProcAddress((const GLubyte*)"glPrimitiveRestartNV")) == NULL) || r;
-  return r;
-#endif /* GL_NV_primitive_restart */
-#ifdef GL_NV_register_combiners
-static GLboolean _glewInit_GL_NV_register_combiners (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glCombinerInputNV = (PFNGLCOMBINERINPUTNVPROC)glewGetProcAddress((const GLubyte*)"glCombinerInputNV")) == NULL) || r;
-  r = ((glCombinerOutputNV = (PFNGLCOMBINEROUTPUTNVPROC)glewGetProcAddress((const GLubyte*)"glCombinerOutputNV")) == NULL) || r;
-  r = ((glCombinerParameterfNV = (PFNGLCOMBINERPARAMETERFNVPROC)glewGetProcAddress((const GLubyte*)"glCombinerParameterfNV")) == NULL) || r;
-  r = ((glCombinerParameterfvNV = (PFNGLCOMBINERPARAMETERFVNVPROC)glewGetProcAddress((const GLubyte*)"glCombinerParameterfvNV")) == NULL) || r;
-  r = ((glCombinerParameteriNV = (PFNGLCOMBINERPARAMETERINVPROC)glewGetProcAddress((const GLubyte*)"glCombinerParameteriNV")) == NULL) || r;
-  r = ((glCombinerParameterivNV = (PFNGLCOMBINERPARAMETERIVNVPROC)glewGetProcAddress((const GLubyte*)"glCombinerParameterivNV")) == NULL) || r;
-  r = ((glFinalCombinerInputNV = (PFNGLFINALCOMBINERINPUTNVPROC)glewGetProcAddress((const GLubyte*)"glFinalCombinerInputNV")) == NULL) || r;
-  r = ((glGetCombinerInputParameterfvNV = (PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC)glewGetProcAddress((const GLubyte*)"glGetCombinerInputParameterfvNV")) == NULL) || r;
-  r = ((glGetCombinerInputParameterivNV = (PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC)glewGetProcAddress((const GLubyte*)"glGetCombinerInputParameterivNV")) == NULL) || r;
-  r = ((glGetCombinerOutputParameterfvNV = (PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC)glewGetProcAddress((const GLubyte*)"glGetCombinerOutputParameterfvNV")) == NULL) || r;
-  r = ((glGetCombinerOutputParameterivNV = (PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC)glewGetProcAddress((const GLubyte*)"glGetCombinerOutputParameterivNV")) == NULL) || r;
-  r = ((glGetFinalCombinerInputParameterfvNV = (PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC)glewGetProcAddress((const GLubyte*)"glGetFinalCombinerInputParameterfvNV")) == NULL) || r;
-  r = ((glGetFinalCombinerInputParameterivNV = (PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC)glewGetProcAddress((const GLubyte*)"glGetFinalCombinerInputParameterivNV")) == NULL) || r;
-  return r;
-#endif /* GL_NV_register_combiners */
-#ifdef GL_NV_register_combiners2
-static GLboolean _glewInit_GL_NV_register_combiners2 (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glCombinerStageParameterfvNV = (PFNGLCOMBINERSTAGEPARAMETERFVNVPROC)glewGetProcAddress((const GLubyte*)"glCombinerStageParameterfvNV")) == NULL) || r;
-  r = ((glGetCombinerStageParameterfvNV = (PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC)glewGetProcAddress((const GLubyte*)"glGetCombinerStageParameterfvNV")) == NULL) || r;
-  return r;
-#endif /* GL_NV_register_combiners2 */
-#ifdef GL_NV_texgen_emboss
-#endif /* GL_NV_texgen_emboss */
-#ifdef GL_NV_texgen_reflection
-#endif /* GL_NV_texgen_reflection */
-#ifdef GL_NV_texture_compression_vtc
-#endif /* GL_NV_texture_compression_vtc */
-#ifdef GL_NV_texture_env_combine4
-#endif /* GL_NV_texture_env_combine4 */
-#ifdef GL_NV_texture_expand_normal
-#endif /* GL_NV_texture_expand_normal */
-#ifdef GL_NV_texture_rectangle
-#endif /* GL_NV_texture_rectangle */
-#ifdef GL_NV_texture_shader
-#endif /* GL_NV_texture_shader */
-#ifdef GL_NV_texture_shader2
-#endif /* GL_NV_texture_shader2 */
-#ifdef GL_NV_texture_shader3
-#endif /* GL_NV_texture_shader3 */
-#ifdef GL_NV_vertex_array_range
-static GLboolean _glewInit_GL_NV_vertex_array_range (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glFlushVertexArrayRangeNV = (PFNGLFLUSHVERTEXARRAYRANGENVPROC)glewGetProcAddress((const GLubyte*)"glFlushVertexArrayRangeNV")) == NULL) || r;
-  r = ((glVertexArrayRangeNV = (PFNGLVERTEXARRAYRANGENVPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayRangeNV")) == NULL) || r;
-  return r;
-#endif /* GL_NV_vertex_array_range */
-#ifdef GL_NV_vertex_array_range2
-#endif /* GL_NV_vertex_array_range2 */
-#ifdef GL_NV_vertex_program
-static GLboolean _glewInit_GL_NV_vertex_program (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glAreProgramsResidentNV = (PFNGLAREPROGRAMSRESIDENTNVPROC)glewGetProcAddress((const GLubyte*)"glAreProgramsResidentNV")) == NULL) || r;
-  r = ((glBindProgramNV = (PFNGLBINDPROGRAMNVPROC)glewGetProcAddress((const GLubyte*)"glBindProgramNV")) == NULL) || r;
-  r = ((glDeleteProgramsNV = (PFNGLDELETEPROGRAMSNVPROC)glewGetProcAddress((const GLubyte*)"glDeleteProgramsNV")) == NULL) || r;
-  r = ((glExecuteProgramNV = (PFNGLEXECUTEPROGRAMNVPROC)glewGetProcAddress((const GLubyte*)"glExecuteProgramNV")) == NULL) || r;
-  r = ((glGenProgramsNV = (PFNGLGENPROGRAMSNVPROC)glewGetProcAddress((const GLubyte*)"glGenProgramsNV")) == NULL) || r;
-  r = ((glGetProgramParameterdvNV = (PFNGLGETPROGRAMPARAMETERDVNVPROC)glewGetProcAddress((const GLubyte*)"glGetProgramParameterdvNV")) == NULL) || r;
-  r = ((glGetProgramParameterfvNV = (PFNGLGETPROGRAMPARAMETERFVNVPROC)glewGetProcAddress((const GLubyte*)"glGetProgramParameterfvNV")) == NULL) || r;
-  r = ((glGetProgramStringNV = (PFNGLGETPROGRAMSTRINGNVPROC)glewGetProcAddress((const GLubyte*)"glGetProgramStringNV")) == NULL) || r;
-  r = ((glGetProgramivNV = (PFNGLGETPROGRAMIVNVPROC)glewGetProcAddress((const GLubyte*)"glGetProgramivNV")) == NULL) || r;
-  r = ((glGetTrackMatrixivNV = (PFNGLGETTRACKMATRIXIVNVPROC)glewGetProcAddress((const GLubyte*)"glGetTrackMatrixivNV")) == NULL) || r;
-  r = ((glGetVertexAttribPointervNV = (PFNGLGETVERTEXATTRIBPOINTERVNVPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribPointervNV")) == NULL) || r;
-  r = ((glGetVertexAttribdvNV = (PFNGLGETVERTEXATTRIBDVNVPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribdvNV")) == NULL) || r;
-  r = ((glGetVertexAttribfvNV = (PFNGLGETVERTEXATTRIBFVNVPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribfvNV")) == NULL) || r;
-  r = ((glGetVertexAttribivNV = (PFNGLGETVERTEXATTRIBIVNVPROC)glewGetProcAddress((const GLubyte*)"glGetVertexAttribivNV")) == NULL) || r;
-  r = ((glIsProgramNV = (PFNGLISPROGRAMNVPROC)glewGetProcAddress((const GLubyte*)"glIsProgramNV")) == NULL) || r;
-  r = ((glLoadProgramNV = (PFNGLLOADPROGRAMNVPROC)glewGetProcAddress((const GLubyte*)"glLoadProgramNV")) == NULL) || r;
-  r = ((glProgramParameter4dNV = (PFNGLPROGRAMPARAMETER4DNVPROC)glewGetProcAddress((const GLubyte*)"glProgramParameter4dNV")) == NULL) || r;
-  r = ((glProgramParameter4dvNV = (PFNGLPROGRAMPARAMETER4DVNVPROC)glewGetProcAddress((const GLubyte*)"glProgramParameter4dvNV")) == NULL) || r;
-  r = ((glProgramParameter4fNV = (PFNGLPROGRAMPARAMETER4FNVPROC)glewGetProcAddress((const GLubyte*)"glProgramParameter4fNV")) == NULL) || r;
-  r = ((glProgramParameter4fvNV = (PFNGLPROGRAMPARAMETER4FVNVPROC)glewGetProcAddress((const GLubyte*)"glProgramParameter4fvNV")) == NULL) || r;
-  r = ((glProgramParameters4dvNV = (PFNGLPROGRAMPARAMETERS4DVNVPROC)glewGetProcAddress((const GLubyte*)"glProgramParameters4dvNV")) == NULL) || r;
-  r = ((glProgramParameters4fvNV = (PFNGLPROGRAMPARAMETERS4FVNVPROC)glewGetProcAddress((const GLubyte*)"glProgramParameters4fvNV")) == NULL) || r;
-  r = ((glRequestResidentProgramsNV = (PFNGLREQUESTRESIDENTPROGRAMSNVPROC)glewGetProcAddress((const GLubyte*)"glRequestResidentProgramsNV")) == NULL) || r;
-  r = ((glTrackMatrixNV = (PFNGLTRACKMATRIXNVPROC)glewGetProcAddress((const GLubyte*)"glTrackMatrixNV")) == NULL) || r;
-  r = ((glVertexAttrib1dNV = (PFNGLVERTEXATTRIB1DNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1dNV")) == NULL) || r;
-  r = ((glVertexAttrib1dvNV = (PFNGLVERTEXATTRIB1DVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1dvNV")) == NULL) || r;
-  r = ((glVertexAttrib1fNV = (PFNGLVERTEXATTRIB1FNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1fNV")) == NULL) || r;
-  r = ((glVertexAttrib1fvNV = (PFNGLVERTEXATTRIB1FVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1fvNV")) == NULL) || r;
-  r = ((glVertexAttrib1sNV = (PFNGLVERTEXATTRIB1SNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1sNV")) == NULL) || r;
-  r = ((glVertexAttrib1svNV = (PFNGLVERTEXATTRIB1SVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib1svNV")) == NULL) || r;
-  r = ((glVertexAttrib2dNV = (PFNGLVERTEXATTRIB2DNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2dNV")) == NULL) || r;
-  r = ((glVertexAttrib2dvNV = (PFNGLVERTEXATTRIB2DVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2dvNV")) == NULL) || r;
-  r = ((glVertexAttrib2fNV = (PFNGLVERTEXATTRIB2FNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2fNV")) == NULL) || r;
-  r = ((glVertexAttrib2fvNV = (PFNGLVERTEXATTRIB2FVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2fvNV")) == NULL) || r;
-  r = ((glVertexAttrib2sNV = (PFNGLVERTEXATTRIB2SNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2sNV")) == NULL) || r;
-  r = ((glVertexAttrib2svNV = (PFNGLVERTEXATTRIB2SVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib2svNV")) == NULL) || r;
-  r = ((glVertexAttrib3dNV = (PFNGLVERTEXATTRIB3DNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3dNV")) == NULL) || r;
-  r = ((glVertexAttrib3dvNV = (PFNGLVERTEXATTRIB3DVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3dvNV")) == NULL) || r;
-  r = ((glVertexAttrib3fNV = (PFNGLVERTEXATTRIB3FNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3fNV")) == NULL) || r;
-  r = ((glVertexAttrib3fvNV = (PFNGLVERTEXATTRIB3FVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3fvNV")) == NULL) || r;
-  r = ((glVertexAttrib3sNV = (PFNGLVERTEXATTRIB3SNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3sNV")) == NULL) || r;
-  r = ((glVertexAttrib3svNV = (PFNGLVERTEXATTRIB3SVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib3svNV")) == NULL) || r;
-  r = ((glVertexAttrib4dNV = (PFNGLVERTEXATTRIB4DNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4dNV")) == NULL) || r;
-  r = ((glVertexAttrib4dvNV = (PFNGLVERTEXATTRIB4DVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4dvNV")) == NULL) || r;
-  r = ((glVertexAttrib4fNV = (PFNGLVERTEXATTRIB4FNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4fNV")) == NULL) || r;
-  r = ((glVertexAttrib4fvNV = (PFNGLVERTEXATTRIB4FVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4fvNV")) == NULL) || r;
-  r = ((glVertexAttrib4sNV = (PFNGLVERTEXATTRIB4SNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4sNV")) == NULL) || r;
-  r = ((glVertexAttrib4svNV = (PFNGLVERTEXATTRIB4SVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4svNV")) == NULL) || r;
-  r = ((glVertexAttrib4ubNV = (PFNGLVERTEXATTRIB4UBNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4ubNV")) == NULL) || r;
-  r = ((glVertexAttrib4ubvNV = (PFNGLVERTEXATTRIB4UBVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttrib4ubvNV")) == NULL) || r;
-  r = ((glVertexAttribPointerNV = (PFNGLVERTEXATTRIBPOINTERNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribPointerNV")) == NULL) || r;
-  r = ((glVertexAttribs1dvNV = (PFNGLVERTEXATTRIBS1DVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs1dvNV")) == NULL) || r;
-  r = ((glVertexAttribs1fvNV = (PFNGLVERTEXATTRIBS1FVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs1fvNV")) == NULL) || r;
-  r = ((glVertexAttribs1svNV = (PFNGLVERTEXATTRIBS1SVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs1svNV")) == NULL) || r;
-  r = ((glVertexAttribs2dvNV = (PFNGLVERTEXATTRIBS2DVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs2dvNV")) == NULL) || r;
-  r = ((glVertexAttribs2fvNV = (PFNGLVERTEXATTRIBS2FVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs2fvNV")) == NULL) || r;
-  r = ((glVertexAttribs2svNV = (PFNGLVERTEXATTRIBS2SVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs2svNV")) == NULL) || r;
-  r = ((glVertexAttribs3dvNV = (PFNGLVERTEXATTRIBS3DVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs3dvNV")) == NULL) || r;
-  r = ((glVertexAttribs3fvNV = (PFNGLVERTEXATTRIBS3FVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs3fvNV")) == NULL) || r;
-  r = ((glVertexAttribs3svNV = (PFNGLVERTEXATTRIBS3SVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs3svNV")) == NULL) || r;
-  r = ((glVertexAttribs4dvNV = (PFNGLVERTEXATTRIBS4DVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs4dvNV")) == NULL) || r;
-  r = ((glVertexAttribs4fvNV = (PFNGLVERTEXATTRIBS4FVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs4fvNV")) == NULL) || r;
-  r = ((glVertexAttribs4svNV = (PFNGLVERTEXATTRIBS4SVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs4svNV")) == NULL) || r;
-  r = ((glVertexAttribs4ubvNV = (PFNGLVERTEXATTRIBS4UBVNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribs4ubvNV")) == NULL) || r;
-  return r;
-#endif /* GL_NV_vertex_program */
-#ifdef GL_NV_vertex_program1_1
-#endif /* GL_NV_vertex_program1_1 */
-#ifdef GL_NV_vertex_program2
-#endif /* GL_NV_vertex_program2 */
-#ifdef GL_NV_vertex_program2_option
-#endif /* GL_NV_vertex_program2_option */
-#ifdef GL_NV_vertex_program3
-#endif /* GL_NV_vertex_program3 */
-#ifdef GL_OML_interlace
-#endif /* GL_OML_interlace */
-#ifdef GL_OML_resample
-#endif /* GL_OML_resample */
-#ifdef GL_OML_subsample
-#endif /* GL_OML_subsample */
-#ifdef GL_PGI_misc_hints
-#endif /* GL_PGI_misc_hints */
-#ifdef GL_PGI_vertex_hints
-#endif /* GL_PGI_vertex_hints */
-#ifdef GL_REND_screen_coordinates
-#endif /* GL_REND_screen_coordinates */
-#ifdef GL_S3_s3tc
-#endif /* GL_S3_s3tc */
-#ifdef GL_SGIS_color_range
-#endif /* GL_SGIS_color_range */
-#ifdef GL_SGIS_detail_texture
-static GLboolean _glewInit_GL_SGIS_detail_texture (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glDetailTexFuncSGIS = (PFNGLDETAILTEXFUNCSGISPROC)glewGetProcAddress((const GLubyte*)"glDetailTexFuncSGIS")) == NULL) || r;
-  r = ((glGetDetailTexFuncSGIS = (PFNGLGETDETAILTEXFUNCSGISPROC)glewGetProcAddress((const GLubyte*)"glGetDetailTexFuncSGIS")) == NULL) || r;
-  return r;
-#endif /* GL_SGIS_detail_texture */
-#ifdef GL_SGIS_fog_function
-static GLboolean _glewInit_GL_SGIS_fog_function (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glFogFuncSGIS = (PFNGLFOGFUNCSGISPROC)glewGetProcAddress((const GLubyte*)"glFogFuncSGIS")) == NULL) || r;
-  r = ((glGetFogFuncSGIS = (PFNGLGETFOGFUNCSGISPROC)glewGetProcAddress((const GLubyte*)"glGetFogFuncSGIS")) == NULL) || r;
-  return r;
-#endif /* GL_SGIS_fog_function */
-#ifdef GL_SGIS_generate_mipmap
-#endif /* GL_SGIS_generate_mipmap */
-#ifdef GL_SGIS_multisample
-static GLboolean _glewInit_GL_SGIS_multisample (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glSampleMaskSGIS = (PFNGLSAMPLEMASKSGISPROC)glewGetProcAddress((const GLubyte*)"glSampleMaskSGIS")) == NULL) || r;
-  r = ((glSamplePatternSGIS = (PFNGLSAMPLEPATTERNSGISPROC)glewGetProcAddress((const GLubyte*)"glSamplePatternSGIS")) == NULL) || r;
-  return r;
-#endif /* GL_SGIS_multisample */
-#ifdef GL_SGIS_pixel_texture
-#endif /* GL_SGIS_pixel_texture */
-#ifdef GL_SGIS_sharpen_texture
-static GLboolean _glewInit_GL_SGIS_sharpen_texture (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glGetSharpenTexFuncSGIS = (PFNGLGETSHARPENTEXFUNCSGISPROC)glewGetProcAddress((const GLubyte*)"glGetSharpenTexFuncSGIS")) == NULL) || r;
-  r = ((glSharpenTexFuncSGIS = (PFNGLSHARPENTEXFUNCSGISPROC)glewGetProcAddress((const GLubyte*)"glSharpenTexFuncSGIS")) == NULL) || r;
-  return r;
-#endif /* GL_SGIS_sharpen_texture */
-#ifdef GL_SGIS_texture4D
-static GLboolean _glewInit_GL_SGIS_texture4D (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glTexImage4DSGIS = (PFNGLTEXIMAGE4DSGISPROC)glewGetProcAddress((const GLubyte*)"glTexImage4DSGIS")) == NULL) || r;
-  r = ((glTexSubImage4DSGIS = (PFNGLTEXSUBIMAGE4DSGISPROC)glewGetProcAddress((const GLubyte*)"glTexSubImage4DSGIS")) == NULL) || r;
-  return r;
-#endif /* GL_SGIS_texture4D */
-#ifdef GL_SGIS_texture_border_clamp
-#endif /* GL_SGIS_texture_border_clamp */
-#ifdef GL_SGIS_texture_edge_clamp
-#endif /* GL_SGIS_texture_edge_clamp */
-#ifdef GL_SGIS_texture_filter4
-static GLboolean _glewInit_GL_SGIS_texture_filter4 (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glGetTexFilterFuncSGIS = (PFNGLGETTEXFILTERFUNCSGISPROC)glewGetProcAddress((const GLubyte*)"glGetTexFilterFuncSGIS")) == NULL) || r;
-  r = ((glTexFilterFuncSGIS = (PFNGLTEXFILTERFUNCSGISPROC)glewGetProcAddress((const GLubyte*)"glTexFilterFuncSGIS")) == NULL) || r;
-  return r;
-#endif /* GL_SGIS_texture_filter4 */
-#ifdef GL_SGIS_texture_lod
-#endif /* GL_SGIS_texture_lod */
-#ifdef GL_SGIS_texture_select
-#endif /* GL_SGIS_texture_select */
-#ifdef GL_SGIX_async
-static GLboolean _glewInit_GL_SGIX_async (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glAsyncMarkerSGIX = (PFNGLASYNCMARKERSGIXPROC)glewGetProcAddress((const GLubyte*)"glAsyncMarkerSGIX")) == NULL) || r;
-  r = ((glDeleteAsyncMarkersSGIX = (PFNGLDELETEASYNCMARKERSSGIXPROC)glewGetProcAddress((const GLubyte*)"glDeleteAsyncMarkersSGIX")) == NULL) || r;
-  r = ((glFinishAsyncSGIX = (PFNGLFINISHASYNCSGIXPROC)glewGetProcAddress((const GLubyte*)"glFinishAsyncSGIX")) == NULL) || r;
-  r = ((glGenAsyncMarkersSGIX = (PFNGLGENASYNCMARKERSSGIXPROC)glewGetProcAddress((const GLubyte*)"glGenAsyncMarkersSGIX")) == NULL) || r;
-  r = ((glIsAsyncMarkerSGIX = (PFNGLISASYNCMARKERSGIXPROC)glewGetProcAddress((const GLubyte*)"glIsAsyncMarkerSGIX")) == NULL) || r;
-  r = ((glPollAsyncSGIX = (PFNGLPOLLASYNCSGIXPROC)glewGetProcAddress((const GLubyte*)"glPollAsyncSGIX")) == NULL) || r;
-  return r;
-#endif /* GL_SGIX_async */
-#ifdef GL_SGIX_async_histogram
-#endif /* GL_SGIX_async_histogram */
-#ifdef GL_SGIX_async_pixel
-#endif /* GL_SGIX_async_pixel */
-#ifdef GL_SGIX_blend_alpha_minmax
-#endif /* GL_SGIX_blend_alpha_minmax */
-#ifdef GL_SGIX_clipmap
-#endif /* GL_SGIX_clipmap */
-#ifdef GL_SGIX_depth_texture
-#endif /* GL_SGIX_depth_texture */
-#ifdef GL_SGIX_flush_raster
-static GLboolean _glewInit_GL_SGIX_flush_raster (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glFlushRasterSGIX = (PFNGLFLUSHRASTERSGIXPROC)glewGetProcAddress((const GLubyte*)"glFlushRasterSGIX")) == NULL) || r;
-  return r;
-#endif /* GL_SGIX_flush_raster */
-#ifdef GL_SGIX_fog_offset
-#endif /* GL_SGIX_fog_offset */
-#ifdef GL_SGIX_fog_texture
-static GLboolean _glewInit_GL_SGIX_fog_texture (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glTextureFogSGIX = (PFNGLTEXTUREFOGSGIXPROC)glewGetProcAddress((const GLubyte*)"glTextureFogSGIX")) == NULL) || r;
-  return r;
-#endif /* GL_SGIX_fog_texture */
-#ifdef GL_SGIX_fragment_specular_lighting
-static GLboolean _glewInit_GL_SGIX_fragment_specular_lighting (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glFragmentColorMaterialSGIX = (PFNGLFRAGMENTCOLORMATERIALSGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentColorMaterialSGIX")) == NULL) || r;
-  r = ((glFragmentLightModelfSGIX = (PFNGLFRAGMENTLIGHTMODELFSGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightModelfSGIX")) == NULL) || r;
-  r = ((glFragmentLightModelfvSGIX = (PFNGLFRAGMENTLIGHTMODELFVSGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightModelfvSGIX")) == NULL) || r;
-  r = ((glFragmentLightModeliSGIX = (PFNGLFRAGMENTLIGHTMODELISGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightModeliSGIX")) == NULL) || r;
-  r = ((glFragmentLightModelivSGIX = (PFNGLFRAGMENTLIGHTMODELIVSGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightModelivSGIX")) == NULL) || r;
-  r = ((glFragmentLightfSGIX = (PFNGLFRAGMENTLIGHTFSGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightfSGIX")) == NULL) || r;
-  r = ((glFragmentLightfvSGIX = (PFNGLFRAGMENTLIGHTFVSGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightfvSGIX")) == NULL) || r;
-  r = ((glFragmentLightiSGIX = (PFNGLFRAGMENTLIGHTISGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightiSGIX")) == NULL) || r;
-  r = ((glFragmentLightivSGIX = (PFNGLFRAGMENTLIGHTIVSGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentLightivSGIX")) == NULL) || r;
-  r = ((glFragmentMaterialfSGIX = (PFNGLFRAGMENTMATERIALFSGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentMaterialfSGIX")) == NULL) || r;
-  r = ((glFragmentMaterialfvSGIX = (PFNGLFRAGMENTMATERIALFVSGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentMaterialfvSGIX")) == NULL) || r;
-  r = ((glFragmentMaterialiSGIX = (PFNGLFRAGMENTMATERIALISGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentMaterialiSGIX")) == NULL) || r;
-  r = ((glFragmentMaterialivSGIX = (PFNGLFRAGMENTMATERIALIVSGIXPROC)glewGetProcAddress((const GLubyte*)"glFragmentMaterialivSGIX")) == NULL) || r;
-  r = ((glGetFragmentLightfvSGIX = (PFNGLGETFRAGMENTLIGHTFVSGIXPROC)glewGetProcAddress((const GLubyte*)"glGetFragmentLightfvSGIX")) == NULL) || r;
-  r = ((glGetFragmentLightivSGIX = (PFNGLGETFRAGMENTLIGHTIVSGIXPROC)glewGetProcAddress((const GLubyte*)"glGetFragmentLightivSGIX")) == NULL) || r;
-  r = ((glGetFragmentMaterialfvSGIX = (PFNGLGETFRAGMENTMATERIALFVSGIXPROC)glewGetProcAddress((const GLubyte*)"glGetFragmentMaterialfvSGIX")) == NULL) || r;
-  r = ((glGetFragmentMaterialivSGIX = (PFNGLGETFRAGMENTMATERIALIVSGIXPROC)glewGetProcAddress((const GLubyte*)"glGetFragmentMaterialivSGIX")) == NULL) || r;
-  return r;
-#endif /* GL_SGIX_fragment_specular_lighting */
-#ifdef GL_SGIX_framezoom
-static GLboolean _glewInit_GL_SGIX_framezoom (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glFrameZoomSGIX = (PFNGLFRAMEZOOMSGIXPROC)glewGetProcAddress((const GLubyte*)"glFrameZoomSGIX")) == NULL) || r;
-  return r;
-#endif /* GL_SGIX_framezoom */
-#ifdef GL_SGIX_interlace
-#endif /* GL_SGIX_interlace */
-#ifdef GL_SGIX_ir_instrument1
-#endif /* GL_SGIX_ir_instrument1 */
-#ifdef GL_SGIX_list_priority
-#endif /* GL_SGIX_list_priority */
-#ifdef GL_SGIX_pixel_texture
-static GLboolean _glewInit_GL_SGIX_pixel_texture (GLEW_CONTEXT_ARG_DEF_INIT)
-  GLboolean r = GL_FALSE;
-  r = ((glPixelTexGenSGIX = (PFNGLPIXELTEXGENSGIXPROC)glewGetProcAddress((const GLubyte*)"glPixelTexGenSGIX")) == NULL) || r;
-  return r;
-#endif /* GL_SGIX_pixel_texture */
-#ifdef GL_SGIX_pixel_texture_bits
-#endif /* GL_SGIX_pixel_texture_bits */
-#ifdef GL_SGIX_reference_plane